KEGG   Agrobacterium fabrum: Atu5240Help
Entry
Atu5240           CDS       T00070                                 

Gene name
adhP
Definition
alcohol dehydrogenase
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
atu  Agrobacterium fabrum
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:atu00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Atu5240 (adhP)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Atu5240 (adhP)
  Lipid metabolism
   00071 Fatty acid degradation
    Atu5240 (adhP)
  Amino acid metabolism
   00350 Tyrosine metabolism
    Atu5240 (adhP)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Atu5240 (adhP)
   00626 Naphthalene degradation
    Atu5240 (adhP)
Enzymes [BR:atu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Atu5240 (adhP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
AT:complement(236265..237287)
Genome map
AA seq 340 aa AA seqDB search
MKAVVMTGANQPWEVQEVPVPKAEPGLVLVKIHASGMCYTDVWATQGAGGDIYPQTPGHE
VVGEIIEVGAGVHTRKVGDRVGTTWVQSSCGRCSYCRQNRPLTGQTAMNCDSPRTTGFAT
QGGHAEYIAISAEGTVLLPDGLDYTDAAPMMCAGYTTWSGLRDAEPKPGDRIAVLGIGGL
GHVAVQFSKALGFETIAITHSPDKHKLATDLGADIVVADGKELLEAGGADVLLVTTNDFD
TAEKAMAGVRPDGRIVLCALDFSKPFSIPSDGKPFHMMRQRVVGSTHGGQHYLAEILDLA
AKGKVKPIVETFALEQATEAYERLSTGKMRFRGVFLPHGA
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgaaagctgttgtcatgaccggggcgaaccagccttgggaggttcaagaggttcccgtt
ccgaaggcagagccaggacttgtccttgttaaaatccacgcctccggcatgtgctacacg
gacgtgtgggcgacgcagggtgccggtggcgacatctatccgcagacccccggccatgag
gttgtcggcgagatcatcgaggtcggcgcgggcgttcatacgcgcaaggtgggagaccgg
gtcggcaccacctgggtgcagtcctcttgtggacgatgctcctactgccgccagaaccgt
ccgttgaccggccagacagccatgaactgcgattcacccaggacaacggggttcgcgacg
caaggcgggcacgcagagtacatcgcgatctctgctgaaggcacagtgttattacccgac
gggctcgactacacggatgccgcacccatgatgtgcgcaggctacacgacctggagcggc
ttgcgcgacgccgagcccaaacctggtgacagaattgcggtacttggcatcggcgggctg
gggcacgtcgccgtgcagttctccaaagccttggggtttgagaccatcgcgatcacgcat
tcacccgacaagcacaagttggccaccgatcttggtgcagacatcgtcgtcgccgatggc
aaagagttattggaggccggcggtgcggacgttcttctggttacgaccaacgacttcgac
accgccgaaaaagcgatggcgggcgtaaggcctgacgggcgcatcgttctttgcgcgctc
gacttcagcaagccgttctcgatcccgtccgacggcaagccgttccacatgatgcgccaa
cgcgtggttgggtccacgcatggcggacagcactatctcgccgaaatcctcgatctcgcc
gccaagggcaaggtcaagccgattgtcgagaccttcgccctcgagcaggcaaccgaggca
tatgagcggctatccaccgggaagatgcgcttccggggcgtgttccttccgcacggcgct
tga

DBGET integrated database retrieval system