KEGG   Agrobacterium tumefaciens C58: Atu5284Help
Entry
Atu5284           CDS       T00070                                 

Definition
alpha-amylase
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
atu  Agrobacterium tumefaciens C58
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:atu00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
AT:complement(280768..282552)
Genome map
AA seq 594 aa AA seqDB search
MNAANYRKWGAQRHQSGDTDFSIWAPASATVKLWLNDAEFDMHTAGDGWHDITKPALPGD
RYGFVLADRTRVADPASNRQQEGPRGPSLIVNHDFAWKNPNWKGRPWHEAVVYELHIGTF
TPEGTFAAAAEKLEYLADVGITTIELMPLATFAGSRGWGYDGVLQFSPQRDYGTPDELKA
FIDQAHGHGIMVLLDVVYNHFGPAGNTLQAYAPAFFKKHETPWGPAPDFNRAEVRSFFLQ
NAFYWLETYRFDGLRIDAADHLAGGDGEVDFLIEMAREVKRTIRNRHVHLVIEDARNAAS
PMTPMADGAILVDAQWNDDFHHVIHVATTNEEGGIYEDFASRPYENLRRSLATGFVYQGE
PRPSRNFAASGEPSGHLPPHRFVNFLHNHDQAGNRLRGERLRALIPPPLFGTLEAILLLC
PQTPLVFMGDEHGSANPFFFFSDHPDHNREQEIRNRLKQAESFQGELPPDASQMVMDPND
QHTMQLSTLKWTHAETTEGRQSRADMAALLAKRRGHIWPLLCSHFEKGISLDCEPRCLAI
DWHFKAGRLEMRANLSENMCELPAVKGEILHRNGSVGNTRYEGYAAQFAIYAGR
NT seq 1785 nt NT seq  +upstreamnt  +downstreamnt
atgaatgcagcgaattatcgcaaatggggtgcgcagcgccatcaatccggcgacacggat
ttcagcatctgggcacccgcctcggcaacagtgaaactgtggctgaacgatgcggaattc
gacatgcacacggctggtgatggctggcacgacatcacaaaacccgccctccccggcgat
cgctatggcttcgtgctggccgacaggacgagggttgcagatcccgcttccaaccggcag
caggaaggcccgcgtggcccctccctgatcgtcaaccatgatttcgcctggaaaaacccg
aactggaagggccggccttggcacgaagcagtcgtctatgagctccatatcgggactttt
acacccgagggcacctttgccgccgcggcagagaaacttgaatatcttgcagacgtgggc
attaccaccatcgaacttatgccgcttgcgacctttgctggaagtcgcggctggggttac
gacggcgtcctgcaattttcaccgcagcgggattatggcactccagacgagctcaaggct
ttcattgatcaagcccatggccatggcatcatggtgctgttggatgtcgtctacaatcac
ttcggccccgcaggaaatacccttcaggcctacgcgccggcatttttcaagaagcatgag
acaccgtggggacccgcgccggacttcaaccgtgccgaagttcggtcgttctttcttcag
aatgcattctactggctcgagacctatcgctttgacggattgcggatcgatgccgcagat
catctcgctggcggcgacggagaggttgatttccttattgagatggcgcgggaggtgaag
cgcacaataagaaacaggcatgtgcatctggtcatagaggatgcgagaaacgcggcctcg
ccaatgacacccatggccgatggggcgatcttggtcgatgcgcagtggaacgacgatttt
caccacgtcatccacgtggcgaccacgaacgaagagggcggtatctacgaagatttcgcc
agtcggccctatgaaaatcttcgccgctcgctggcgaccggcttcgtctatcagggagaa
ccgcggccctctcggaattttgccgccagcggcgagccgagcgggcatctcccgccccat
cgatttgtgaactttctccataatcacgatcaggccggcaaccgtttgcgcggtgagagg
ctgcgtgccctcataccgccgccgcttttcggcacgctcgaggcgatcctcttgctttgc
ccgcagacgccgctggtcttcatgggggacgagcacggctcggccaacccgttcttcttc
ttttccgaccaccccgaccacaaccgggaacaggaaataaggaaccggcttaaacaggcg
gaaagttttcagggagaactcccgccagatgcttcccagatggtaatggacccgaatgat
cagcacaccatgcagctctctacactgaagtggacccatgcagaaacaaccgaggggaga
cagtcaagagcagacatggccgcgttgcttgcaaaacgccgcgggcacatctggcctctc
ctctgctcacacttcgagaaaggcatttcccttgattgcgagcctcggtgtcttgcaatc
gactggcatttcaaagcgggacggctggaaatgcgggcaaacctttcggaaaacatgtgc
gaactgccggcggtgaaaggagaaatccttcaccggaacggcagcgtcggtaacacgcga
tacgaaggttatgcggcgcaatttgcgatctatgcaggccgctaa

DBGET integrated database retrieval system