KEGG   Agrobacterium tumefaciens C58: Atu6135Help
Entry
Atu6135           CDS       T00070                                 

Definition
sucrose phosphorylase
Orthology
K00690  
sucrose phosphorylase [EC:2.4.1.7]
Organism
atu  Agrobacterium tumefaciens C58
Pathway
Starch and sucrose metabolism
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:atu00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Ti:complement(153761..155218)
Genome map
AA seq 485 aa AA seqDB search
MQNKVQFITYVDRLTRGGFRQLKELVDGKFAGLFGGVHVLPFFNPIDGADAGFDPTDHTI
VDPRLGDWEDVRALSGSVEIMADLIVNHVSSQSGAFTDFIAKGSASEFADMFMTFDKVFP
DGATEEDLLRIYRPRPGLPFSKVTLADGTQRMLWTTFTPEQIDIDVHSAKGTTYLETILD
RFSEANVTAIRLDAAGYAIKKAGSSCFMIDDTYAFLEEVAGKARNRGMEVLVEIHSYHRD
QIEIAKKVDRVYDFALPPLILHALFTGDATPLAKWLAISPRNAITVLDTHDGIGVIDVGA
HSDGRAGLLEPQAIDNLVGEIHRRSDGQSRQATGAAASNLDLYQVNCTYYDALGRNDNDY
LIARAIQFFAPGIPQVYYVGLLGGVNDMDLLAKTGVGRDINRHYYGNDEIGTALETPLFH
RLSNLIRFRNTHPAFGGALKATIADAGALVLSWQHGDAFAELKISFADRKASIAASGQSE
MQIVE
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaacaaagtgcagtttatcacctatgttgaccgcctgaccagaggtggtttcagg
caattgaaggaactggtcgatggcaagttcgctggcctgttcggcggcgtccatgtcttg
cctttcttcaatccgatcgatggcgctgatgccggattcgatccaacagatcacacgatc
gtcgatccgcgcctcggcgactgggaggatgtgcgggctttgtcgggatccgtggaaatc
atggccgatcttatcgtcaaccatgtctcatcgcaatccggcgcattcacggacttcatt
gccaagggttcggcgtccgaatttgccgacatgttcatgacgttcgataaggtatttccc
gatggcgccaccgaagaagaccttctgaggatctatcgaccgcgccccggtttaccgttt
tcgaaggtgaccctggctgatggtactcagcggatgctctggacaaccttcacaccggag
cagatcgacatcgatgtccacagcgccaaaggcacaacctatctcgaaacgatcctcgat
cgcttttcggaggcgaatgtgacggcgatccgcctcgacgccgcgggatacgcgatcaag
aaagcgggcagcagttgcttcatgatcgacgatacctacgcattcctcgaagaagtggct
ggaaaggcccgcaaccgcggcatggaggttctggtcgagattcatagttatcatcgtgac
caaatcgagatcgcgaagaaggtcgaccgggtgtacgatttcgcactaccaccgctcatc
ttgcatgcattgtttacgggagacgccacgccgctggcaaagtggctggcaataagcccc
cgtaacgcgatcaccgttctcgacacccatgacgggattggcgttatagatgtcggtgcc
catagcgacggccgggcgggcctcctcgaaccccaggcgatcgacaatcttgtgggagag
atccataggcgatcggatggccagagccgccaggcgacgggggccgctgcatcgaatctg
gacctttatcaggtaaactgcacctactatgacgcgcttggtcgcaacgataatgattat
ctcatcgctcgggcaattcagttttttgctccaggaattccgcaagtctattatgtcggt
ttattgggcggcgtaaacgatatggacctgctcgccaaaacgggcgtggggcgtgacatt
aaccggcactattacggcaacgacgaaatcggtacggcccttgagacgccgctcttccat
cgcctttcaaatctgatccgtttcaggaacacccatcccgccttcggtggagcgctcaag
gccaccattgctgatgccggagcgttggtgctttcatggcaacacggcgatgcttttgct
gaattgaagatctcatttgccgaccgcaaggcgagcattgccgcatctggtcagagcgag
atgcagatcgtcgagtga

DBGET integrated database retrieval system