KEGG   Aerococcus urinae ACS-120-V-Col10a: HMPREF9243_0031Help
Entry
HMPREF9243_0031   CDS       T01447                                 

Definition
(GenBank) succinyl-diaminopimelate desuccinylase
  KO
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
aur  Aerococcus urinae ACS-120-V-Col10a
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:aur00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    HMPREF9243_0031
  Amino acid metabolism
   00300 Lysine biosynthesis
    HMPREF9243_0031
Enzymes [BR:aur01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     HMPREF9243_0031
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
36885..38030
Genome map
AA seq 381 aa AA seqDB search
MSIDKKVELLQEIIQTETVNGKEKPLAETFAEVFDQAGIETKLVDHDDERASLVAEWQGG
DEGKILALTGHFDVVAADDAQEWSHDPFSGEIVDDYMYGRGTSDMKAGLLGLALALIELK
EEGYELPGSIRFLGTAGEEIGMLGSKALTDAGYTEDIDAILIAEPVNPGEINTSHKGSLN
YQLTASGQAAHSSTPQEGINAIDLLRQAMDHIQEKMNQVTNDYESDVLGRTLHSFTVIEG
GSQENSIPETAIVKANARTIPEYSNDKIIDLLENVVEEVNGQVDGELSLEVTQDSSPVYT
PDDSQLVQACLKELGEETEVTSFNAVTDASNFTQVDKDFDMVIYGPGDLALAHSQDEHIK
VEDYLQFIDHVKAIIKNYFDE
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgtcaattgataagaaagtggaattactacaggaaattatccaaacagaaaccgttaat
ggcaaagaaaaaccattagcagaaacttttgctgaagtctttgaccaagctggcattgaa
acgaagttggttgaccatgatgatgaaagggccagcttagtagccgagtggcaaggcggt
gatgaaggcaagattttggctttaactggacactttgacgtggttgctgctgatgatgcc
caagagtggagtcatgaccctttcagtggcgaaattgtggatgattacatgtatggtcga
ggaacttctgacatgaaggctggtcttcttggcttggccttagccctgattgaactgaaa
gaagaaggctatgaactcccaggtagtattcgcttcttaggaacagctggcgaagagatt
gggatgctaggttccaaggccctgacggatgctgggtatactgaagatattgatgctatc
ctcattgctgaaccggttaatcctggggaaatcaatacttcccataaagggtccttgaat
tatcaactgacagcgagtggtcaagcagcccactcttcaactccacaagaagggattaat
gccattgacttgctgcgtcaagccatggaccatatccaagaaaaaatgaatcaagtcact
aatgactatgaaagtgatgttctgggacgtaccctccattcctttaccgtgattgagggc
gggagtcaagagaactctattccagaaacagctattgtgaaggccaatgcccggaccatt
cctgaatactctaatgacaagattattgacttattggaaaatgttgttgaagaagttaac
ggtcaagtcgacggtgaactgagtttggaagtgacccaagatagttcgcctgtctataca
ccggatgatagtcaattagtccaagcctgcctaaaagaattgggtgaagagacagaagtg
accagctttaatgctgtgactgatgcttctaactttactcaagtggataaggactttgat
atggtcatttatggacctggtgacttggctttagcccatagtcaagatgaacacattaaa
gtagaagactatcttcaatttattgaccacgttaaagcaatcatcaaaaattattttgat
gaataa

DBGET integrated database retrieval system