KEGG   Aerococcus urinae: HMPREF9243_0032Help
Entry
HMPREF9243_0032   CDS       T01447                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase, beta subunit (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
aur  Aerococcus urinae
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:aur00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    HMPREF9243_0032 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HMPREF9243_0032 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    HMPREF9243_0032 (trpB)
Enzymes [BR:aur01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     HMPREF9243_0032 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(38555..39736)
Genome map
AA seq 393 aa AA seqDB search
MTEINNGFYGEFGGCYVPEVVKEELDRIADFYEDIKDDPDFKQELALYLRDYVGRENPLY
YAENFSKHLGGPKIYLKREDLNHLGAHKVNNTIGQVLIAKRMGKKRLIAETGAGQHGVAT
AAVAAKFGLDCTVYMGQKDVERQKLNVFRMELMGTKVVGVKRGAQSLKEAVDAAFEDLID
NYQDTYYLVGSAVGPHPYPSMVKHFQSVISQESKAQILEREGRLPDAVIACIGGGSNAIG
SFAHYLDEPTVKLYGAEGGGKGLDSDQTAATLNLGSIKIEHGMNTYCLVDEEGNTKPSYS
ISAGLDYVAVGPEHAYLKDSHRAEYIAITDDEALAAFQLLSRTEGIIPALESSHALALAA
KLAPEYSSDQILLVTLSGRGDKDVDQVLRILES
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgacagaaattaataatggtttttatggtgaatttggtggctgctatgtccctgaagtg
gtgaaggaagaattggaccggattgccgacttctatgaagacatcaaggacgatcccgac
ttcaaacaagaactggccctttacctacgcgactatgtcggtcgggagaacccgctctac
tacgctgagaacttcagtaagcatttaggcggacccaaaatttacctcaaacgtgaagac
ctcaaccacttaggcgcccacaaggtcaataacaccatcggccaagttctcatcgctaaa
cgcatgggcaagaaacggctcatcgctgaaaccggagccggccaacacggggtggcaaca
gcagccgtcgccgccaaatttggcctagactgcacagtttacatggggcaaaaggatgtg
gagcggcaaaaattaaatgtcttccgaatggaactgatgggaaccaaggttgttggcgtc
aaacgtggggcccaatcccttaaagaagccgtcgatgctgcctttgaagacctgattgac
aattaccaagacacctactacctagtgggctcagccgttggtccccacccttaccccagc
atggtcaagcacttccaaagtgtgattagccaggaaagtaaggcccaaatcctggaacgt
gagggtcgcttacccgacgcagtaatcgcctgcatcgggggcgggtccaatgctattggt
tcctttgcccattatctcgatgagccgactgtcaagctttacggcgctgaaggtggtgga
aaaggcctagacagcgatcaaacggcagccaccttgaatctaggatcgattaagatcgag
cacggcatgaatacctactgcctagttgatgaagaaggcaataccaagccaagttattcc
atctcagccggactcgactatgtggctgtaggaccggaacacgcctatctcaaggacagt
caccgggctgaatatatcgccatcactgacgatgaagccctggctgccttccaactgctt
tcccgcacagaagggatcatcccggccctggagtcctcccatgccctggccctggctgca
aaattagcccctgaatacagctccgatcaaatccttctcgtcaccctatctggacgcggc
gataaggacgtcgaccaagttcttagaatactcgaaagctaa

DBGET integrated database retrieval system