KEGG   Aerococcus urinae: HMPREF9243_0076Help
Entry
HMPREF9243_0076   CDS       T01447                                 

Gene name
adh
Definition
aldehyde-alcohol dehydrogenase 2 (EC:1.1.1.1 1.2.1.10)
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
aur  Aerococcus urinae
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:aur00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    HMPREF9243_0076 (adh)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HMPREF9243_0076 (adh)
   00620 Pyruvate metabolism
    HMPREF9243_0076 (adh)
   00650 Butanoate metabolism
    HMPREF9243_0076 (adh)
  Lipid metabolism
   00071 Fatty acid degradation
    HMPREF9243_0076 (adh)
  Amino acid metabolism
   00350 Tyrosine metabolism
    HMPREF9243_0076 (adh)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    HMPREF9243_0076 (adh)
   00626 Naphthalene degradation
    HMPREF9243_0076 (adh)
Enzymes [BR:aur01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     HMPREF9243_0076 (adh)
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     HMPREF9243_0076 (adh)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
75473..78118
Genome map
AA seq 881 aa AA seqDB search
MAKGKEQKVDIPQFIDETVAKAKQALEDFMALDQEQIDHIVTKASIAALDQHGVLAKHAV
EDTGRGVFEDKATKNLFACEHVTNHMRHLKTVGIIDRDEAKGLTYIAEPVGVICGIVPTT
NPTSTAIFKSLISLKTRNPIVFSFHPQALESSIHAAKVVRDAAIAAGAPENCIQWIDPKH
ASMEATNLLMNHPDVATILATGGSAMVKAAYSCGKPALGVGPGNVPAYVEKTANLKQAVN
DIVMSKAFDNGMVCASEQAAIVDKEIYPAFIKEMKSYHVYFVNQKEKALLEEFCFGAKAN
SEAVDQAKLNADIVGKSAVWIAKEAGFEVPEETVILAAEVPEVGPAQPLTREKLSPVLAI
LKAETTEDGMAKAEAMVEFNGLGHSAAIHTNNHDLEIEYAKRVKVARVIVNAPSTFGGIG
DVYNYFIPSLTLGCGSYGHNSVAGNVGPLDLINIKRVGERQNNMQWFKVPRVYFEKNSIK
YLQELDHVERVSIISDKGIAKLGFVQKVIDQLQQRQNKVVYDVFDNIEPDPDISTVQAGA
DAIRAFQPDTIIAIGGGSVMDSAKIMWLFYERPDVDFRDLVQKFMDIRKRAFRFPALGDK
AQLVAIPTTSGTGSEVTPFAVISDKKNNKKYPLADYALLPKVAIVDSSFVEKVPSRVTAA
TGMDVLTHAIEAYVSIFASDYTDGLSLQVIKLVFDYLEKSVKDFDPLAREKMHNAATMAG
MAFGNAFLGIVHSMSHKIGGVFHTVHGENNAILLPYVIRYNGEKPGKLSTWPKYNYYKAG
ERYQNIARMLGLKANTVDEAVASLAQACYELGEKVGLPMSYQAQGLDKKEWEKALEQLAY
DAYEDQCTPLNPRLPLVPDMMAMMRAAYQGYGKAPEPIKNK
NT seq 2646 nt NT seq  +upstreamnt  +downstreamnt
atggctaaaggaaaagaacaaaaagtagatattccacaatttatcgatgagacagtggct
aaggctaaacaggccttagaagattttatggccttagaccaagagcaaatcgaccatatt
gttactaaggcgtcgattgctgccttagaccaacatggggtcttagctaaacatgccgtt
gaagatactggacggggtgtctttgaagataaggccaccaagaacttatttgcctgtgaa
catgtgaccaaccacatgcgccacttgaaaacagtaggtattattgatcgtgatgaggcc
aagggattgacctatattgctgaaccggtcggggtaatttgtgggattgttcctactacc
aacccaacatcgacagcaatctttaagtccttgatttctttgaagacccgtaatcccatt
gtcttctccttccaccctcaagcgctggaatcttccatccatgcggccaaagtggtgcgg
gacgcagcgattgcggcaggggcacctgaaaactgtatccaatggatcgatccaaaacat
gcctcgatggaagccaccaatttactgatgaaccatcctgatgtggctactatccttgca
accggtggatcggccatggttaaggccgcctattcttgtggcaaacctgccttaggtgtg
ggacctgggaatgtacctgcctatgttgaaaaaacggctaacctcaagcaagccgtgaat
gatattgtcatgagtaaggccttcgataatgggatggtttgtgcttcagaacaagctgcc
attgttgacaaagaaatctaccctgccttcattaaagaaatgaagtcctaccatgtttac
tttgtcaaccaaaaggaaaaagctctcttagaagaattctgctttggagctaaagccaat
agtgaggcggttgaccaagccaaactcaatgccgatattgttggaaaatcagcggtttgg
attgctaaagaagctggctttgaagtccctgaggaaaccgtgatcctagcagcggaagtt
cctgaagtgggcccagcccaaccccttacccgagaaaaattatctccagtgcttgccatc
ttaaaggctgagacgaccgaagatgggatggccaaagctgaagccatggtcgagtttaat
ggtctaggtcactccgccgccatccataccaataaccacgacttagaaatcgaatacgcc
aaacgggtaaaagtggcccgggtcattgtcaatgcaccgtcaacctttggggggattggg
gatgtatataactactttattccctccttaaccctaggctgtgggtcttatggacataac
tctgtagctggtaacgtgggacctttagatttgattaatattaaacgagtaggggagcgg
caaaataacatgcaatggtttaaagtccctcgggtttactttgaaaagaattccattaaa
tacttacaagaattagaccatgtggaaagggtatcgattatttcagataaaggcatcgcc
aaactcggctttgtccaaaaagtcattgaccaactccaacaacggcaaaataaggtggtc
tatgatgtctttgataacattgaaccggatccagatatttccacggttcaagcgggtgct
gacgccattcgtgccttccaaccggataccattattgctattggtgggggatcggttatg
gactccgctaagatcatgtggctcttctatgaacgtcctgacgttgacttccgcgacctg
gttcaaaaattcatggatattagaaaacgggccttccgtttcccagccctcggtgacaaa
gcccaattagtggctatcccaaccacctcagggacaggttccgaagtaacgccttttgcg
gtcatttccgataagaagaacaataagaagtacccgcttgctgactacgccctcttacct
aaggtagctatcgtggattccagctttgttgaaaaggtaccaagtcgggtaactgccgct
accgggatggacgtcttaacccacgctattgaggcttatgtatctatctttgcctcagac
tataccgatggactctctcttcaagttattaagcttgtctttgactacttggaaaaatcg
gtcaaagactttgacccgctagctagagagaagatgcataatgcggcaaccatggcgggg
atggccttcggtaacgccttcctgggaattgttcactccatgtcccataagatcggtggg
gtcttccataccgttcacggggaaaacaatgccatccttctgccttatgtgatccgctac
aacggcgaaaaaccaggtaaactttctacctggccaaaatacaactactacaaggctggt
gaacgttaccaaaacattgcccgtatgctaggattaaaggccaatactgtcgatgaagcc
gttgcttccttggcccaagcctgctatgaactcggtgaaaaagttggtctcccaatgagc
taccaagcccaaggtcttgacaagaaagaatgggaaaaggccttagaacaactggcttat
gatgcttatgaagaccaatgtaccccattaaaccctcgtctgccattagttcctgatatg
atggccatgatgcgggcggcttaccaaggttatggtaaggcaccagagccaattaagaat
aagtaa

DBGET integrated database retrieval system