KEGG   Aerococcus urinae: HMPREF9243_0291Help
Entry
HMPREF9243_0291   CDS       T01447                                 

Gene name
gmuD
Definition
6-phospho-beta-glucosidase GmuD (EC:3.2.1.86)
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
aur  Aerococcus urinae
Pathway
Glycolysis / Gluconeogenesis
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:aur00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
280208..281590
Genome map
AA seq 460 aa AA seqDB search
MIKFPKDFLWGSSTSGPQSEGREAGDGKGDNIWDYWYKIEPFKFHNEIGPGETSTFYKNY
KSDIKLLKKTGHTIFRTSIQWARLFPNGTGDINEEAVKFYKDVFQRVKNEDIQLMVNLYH
FDMPMELQKIGGWENREVVYAYQNYAQTCIELFNDYVDYWITFNEPIVHVECGYLNQYHY
PCKVDPQAAVQVAYHTQLASSLAVKSAHDFNKNIKIGIVLNLTPAYPRSDHPYDKKAANI
AELFQAKSFLDPSVKGEYPRELIELLEEHNLLPSYNKEDLKIISENTVDYLGVNYYQPLR
VKAPVNVRNSDAPFSPEYYYDTYEMPGRKFNPYRGWEIYEQGVYDIAINIKNNYGNIPWI
LTENGMGVEDEDRFRVDGQIQDDYRIEFIQGHLKKLHSAIQEGANCKGYLLWTFIDCWSW
LNAYKNRYGLIELDLKTQNRIVKKSGEWFKQLSENNGFEE
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
atgattaagtttccaaaagattttttatggggaagttcaacatcgggtcctcaaagtgaa
ggtagagaagcaggagacggcaagggagataatatatgggactattggtataaaatagaa
ccgtttaaatttcataatgaaattgggccgggtgaaacttctacattttataaaaattat
aaatctgatataaagttactaaagaaaacaggtcatacaatttttaggacctccatccaa
tgggcacgactatttcctaatggaacaggtgatatcaatgaagaagccgtcaaattctac
aaggatgtcttccaaagagtaaaaaatgaggacattcaattaatggttaatttatatcat
tttgatatgccaatggaactacaaaagattggtggctgggaaaatagagaagtagtctac
gcctatcaaaattatgctcaaacttgtattgagttatttaatgattatgttgattattgg
attacttttaatgaaccaattgtgcatgttgagtgtggctatttaaatcaatatcactat
ccttgtaaagtcgatccccaagctgcagtacaggtagcttatcatactcaattagctagt
tcgttagctgttaagtcagctcatgattttaataaaaatattaagattgggattgtttta
aatttaactcctgcatatccgcggagtgatcacccttatgataaaaaggctgctaatata
gctgaactcttccaagctaaaagctttttagatccatcggttaaaggtgagtatccaaga
gaactcattgaattattagaagaacataatttacttccaagttacaacaaagaagactta
aaaatcatttcagaaaatactgtagattatttaggagttaactattatcaaccactgagg
gtaaaagcgccagtaaatgttagaaatagcgatgcgccctttagccctgaatattattat
gatacttatgaaatgccaggtagaaaatttaacccctaccgcggatgggaaatatatgaa
cagggagtctatgatattgctattaacataaaaaataattacggcaatatcccttggatt
ctgactgaaaatggtatgggagttgaggatgaggatagatttagagttgatgggcaaatc
caagacgattatagaatagagtttattcaggggcacttgaaaaaactgcatagtgctatc
caagagggggctaattgcaaaggttatttgctttggacatttatcgattgttggtcctgg
ctgaatgcgtataaaaatagatatggcctcattgaattagatttaaaaacacagaatagg
attgtaaaaaaatcaggtgaatggtttaaacaactaagcgaaaataacggatttgaggag
tag

DBGET integrated database retrieval system