KEGG   Aerococcus urinae: HMPREF9243_0316Help
Entry
HMPREF9243_0316   CDS       T01447                                 

Definition
firmicute fructose-1,6-bisphosphatase
Orthology
K04041  
fructose-1,6-bisphosphatase III [EC:3.1.3.11]
Organism
aur  Aerococcus urinae
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:aur01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:aur00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:aur00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:aur00051]
Metabolism; Energy metabolism; Methane metabolism [PATH:aur00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(302851..304821)
Genome map
AA seq 656 aa AA seqDB search
MAFSPAFLQLLAEKFPNKAAASTEMINLEAIMSLPKGTEHFMTDLHGEFDAVNHVLRNGS
GNIKEKINEIFGDRLSTKRRAELATIIYYPEEKLRALTKEMDSQAEIDEFYTLTTSRLVE
LTQFVVSKYTRSKVHKAMNPDMAYIMDELIFKDSILSNKEHYYKRIIQSVIDLDEAPRLI
TCLAELIRELVVDHLHILGDIYDRGPAPDQILDLLMEKNSLDIEWGNHDMIWMGAASGSK
ALIANVVRIQARYDNLSVIEHAYGIPLRPLVNLADTVYKDADLTGFMPKLAEDHDYHHDE
VEQLARMQLAMAIIQFKLEAQVIRRHPEFGCDNRLLLDKIDYHAGTINWQGKTYPLVNTS
FPTVDPKDPYALTEEEGAVMEALQAAFLDSERLQKHVAFLINKGSMYKIYNNNLMFHGCI
PMNEDGTFMAATIDGETLAGQVLLDKFDQVVRRMYAQRQSDESKNPDLDFAWYLWQGEGS
ALFGKKQMATFERYFIADKETHQEHRNVYYSWREDIDFVRRVLEEFGIDPDKGHIINGHT
PIKAKDGEDAIKADGKMIVIDGGFAKAYQKTTGLGGFTLLYNSYGMQLVAHHPFHGKEDA
IKYETDIESTRRVVDKELERISVRETDIGKQLTCQVQALKALIEAYQAGLIGEEIE
NT seq 1971 nt NT seq  +upstreamnt  +downstreamnt
atggcatttagtcctgcattcttacaattactggccgaaaaatttcccaacaaggccgcc
gcatccacggaaatgattaacctagaagcgattatgtccctccccaagggcaccgagcac
tttatgaccgacctgcacggggaattcgacgccgttaaccatgtcctccgcaacgggtcg
gggaatatcaaggaaaaaatcaacgaaatcttcggcgaccgcctgtccactaagcgccgg
gccgaactggcgaccattatctactaccccgaagaaaaactccgcgccctgactaaggaa
atggactcgcaggcggaaattgatgagttctataccctgaccaccagccggctggtggaa
ttgacccaatttgtggtctccaagtacacccgctccaaggtccacaaggccatgaatccc
gatatggcctatatcatggatgagttgatcttcaaggactccatcctctccaacaaggaa
cactattataagcgcatcattcaatcggtcattgatctagatgaagcgccccggctgatt
acctgcctggcggaattgatccgggaactggtggtcgaccacctccacatcttaggcgac
atctatgaccgcggacccgctcccgaccagatcttagacctcttaatggagaagaattcg
ctggatattgaatggggcaaccatgacatgatttggatgggcgccgcttcggggtccaaa
gcattaattgccaatgtagtccggatccaggcccgctatgacaatctctctgtgattgaa
cacgcctacggaatcccgctccgtcctcttgtcaacctggctgacaccgtctacaaggat
gctgatttgaccggttttatgcctaaattagctgaggaccatgactaccaccatgacgaa
gtcgagcaattagcccgcatgcagctggctatggccattatccagtttaagttagaggcc
caagtcatccgccgccatcctgaatttggctgtgacaaccgcctgcttttagataagatc
gactaccatgccggaaccattaactggcagggcaagacctatcctttagtcaatacctct
ttccccactgtggatcccaaagatccctatgccctgactgaagaagagggcgcagtcatg
gaagccctgcaagccgcctttttagacagtgaacgcctacaaaagcacgtggccttcctg
attaacaaaggatccatgtataagatttataacaataatctcatgttccacggctgtatc
cccatgaatgaggacggcactttcatggcagctactatcgacggggaaaccttggctggc
caagtcctcctcgacaagtttgaccaggtagtccggcgcatgtatgcccaacgccaaagt
gatgaaagtaaaaaccccgacctggactttgcctggtatctctggcaaggggaagggtca
gccctcttcggaaagaaacaaatggctacctttgaacgctactttatcgccgataaggag
acccaccaggaacaccgcaatgtttattactcctggcgagaagatattgactttgtccgc
cgggtcttagaagagttcggcatcgatcccgacaagggccacatcattaacggccacacc
cctatcaaggctaaagatggagaggacgccattaaggcggatggcaagatgatcgttatt
gacggtggctttgctaaggcctaccaaaagaccaccggactgggcggctttaccctactc
tataattcctatggtatgcagctggtggcccaccaccccttccacggcaaggaggatgcc
attaaatacgaaaccgatattgaatccacccgccgcgtcgtggacaaggagttagaacgg
atttcagttagagaaactgacatcggtaagcaactcacttgccaggtccaagctctcaaa
gccttgattgaagcttatcaagctgggctgattggggaggaaatagaatag

DBGET integrated database retrieval system