KEGG   Aerococcus urinae ACS-120-V-Col10a: HMPREF9243_0316Help
Entry
HMPREF9243_0316   CDS       T01447                                 

Definition
(GenBank) firmicute fructose-1,6-bisphosphatase
  KO
K04041  fructose-1,6-bisphosphatase III [EC:3.1.3.11]
Organism
aur  Aerococcus urinae ACS-120-V-Col10a
Pathway
aur00010  Glycolysis / Gluconeogenesis
aur00030  Pentose phosphate pathway
aur00051  Fructose and mannose metabolism
aur00680  Methane metabolism
aur01100  Metabolic pathways
aur01110  Biosynthesis of secondary metabolites
aur01120  Microbial metabolism in diverse environments
aur01130  Biosynthesis of antibiotics
aur01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:aur00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HMPREF9243_0316
   00030 Pentose phosphate pathway
    HMPREF9243_0316
   00051 Fructose and mannose metabolism
    HMPREF9243_0316
  Energy metabolism
   00680 Methane metabolism
    HMPREF9243_0316
Enzymes [BR:aur01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     HMPREF9243_0316
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FBPase_2 Metallophos
Motif
Other DBs
NCBI-ProteinID: AEA00770
UniProt: F2I6U5
Position
complement(302851..304821)
Genome map
AA seq 656 aa AA seqDB search
MAFSPAFLQLLAEKFPNKAAASTEMINLEAIMSLPKGTEHFMTDLHGEFDAVNHVLRNGS
GNIKEKINEIFGDRLSTKRRAELATIIYYPEEKLRALTKEMDSQAEIDEFYTLTTSRLVE
LTQFVVSKYTRSKVHKAMNPDMAYIMDELIFKDSILSNKEHYYKRIIQSVIDLDEAPRLI
TCLAELIRELVVDHLHILGDIYDRGPAPDQILDLLMEKNSLDIEWGNHDMIWMGAASGSK
ALIANVVRIQARYDNLSVIEHAYGIPLRPLVNLADTVYKDADLTGFMPKLAEDHDYHHDE
VEQLARMQLAMAIIQFKLEAQVIRRHPEFGCDNRLLLDKIDYHAGTINWQGKTYPLVNTS
FPTVDPKDPYALTEEEGAVMEALQAAFLDSERLQKHVAFLINKGSMYKIYNNNLMFHGCI
PMNEDGTFMAATIDGETLAGQVLLDKFDQVVRRMYAQRQSDESKNPDLDFAWYLWQGEGS
ALFGKKQMATFERYFIADKETHQEHRNVYYSWREDIDFVRRVLEEFGIDPDKGHIINGHT
PIKAKDGEDAIKADGKMIVIDGGFAKAYQKTTGLGGFTLLYNSYGMQLVAHHPFHGKEDA
IKYETDIESTRRVVDKELERISVRETDIGKQLTCQVQALKALIEAYQAGLIGEEIE
NT seq 1971 nt NT seq  +upstreamnt  +downstreamnt
atggcatttagtcctgcattcttacaattactggccgaaaaatttcccaacaaggccgcc
gcatccacggaaatgattaacctagaagcgattatgtccctccccaagggcaccgagcac
tttatgaccgacctgcacggggaattcgacgccgttaaccatgtcctccgcaacgggtcg
gggaatatcaaggaaaaaatcaacgaaatcttcggcgaccgcctgtccactaagcgccgg
gccgaactggcgaccattatctactaccccgaagaaaaactccgcgccctgactaaggaa
atggactcgcaggcggaaattgatgagttctataccctgaccaccagccggctggtggaa
ttgacccaatttgtggtctccaagtacacccgctccaaggtccacaaggccatgaatccc
gatatggcctatatcatggatgagttgatcttcaaggactccatcctctccaacaaggaa
cactattataagcgcatcattcaatcggtcattgatctagatgaagcgccccggctgatt
acctgcctggcggaattgatccgggaactggtggtcgaccacctccacatcttaggcgac
atctatgaccgcggacccgctcccgaccagatcttagacctcttaatggagaagaattcg
ctggatattgaatggggcaaccatgacatgatttggatgggcgccgcttcggggtccaaa
gcattaattgccaatgtagtccggatccaggcccgctatgacaatctctctgtgattgaa
cacgcctacggaatcccgctccgtcctcttgtcaacctggctgacaccgtctacaaggat
gctgatttgaccggttttatgcctaaattagctgaggaccatgactaccaccatgacgaa
gtcgagcaattagcccgcatgcagctggctatggccattatccagtttaagttagaggcc
caagtcatccgccgccatcctgaatttggctgtgacaaccgcctgcttttagataagatc
gactaccatgccggaaccattaactggcagggcaagacctatcctttagtcaatacctct
ttccccactgtggatcccaaagatccctatgccctgactgaagaagagggcgcagtcatg
gaagccctgcaagccgcctttttagacagtgaacgcctacaaaagcacgtggccttcctg
attaacaaaggatccatgtataagatttataacaataatctcatgttccacggctgtatc
cccatgaatgaggacggcactttcatggcagctactatcgacggggaaaccttggctggc
caagtcctcctcgacaagtttgaccaggtagtccggcgcatgtatgcccaacgccaaagt
gatgaaagtaaaaaccccgacctggactttgcctggtatctctggcaaggggaagggtca
gccctcttcggaaagaaacaaatggctacctttgaacgctactttatcgccgataaggag
acccaccaggaacaccgcaatgtttattactcctggcgagaagatattgactttgtccgc
cgggtcttagaagagttcggcatcgatcccgacaagggccacatcattaacggccacacc
cctatcaaggctaaagatggagaggacgccattaaggcggatggcaagatgatcgttatt
gacggtggctttgctaaggcctaccaaaagaccaccggactgggcggctttaccctactc
tataattcctatggtatgcagctggtggcccaccaccccttccacggcaaggaggatgcc
attaaatacgaaaccgatattgaatccacccgccgcgtcgtggacaaggagttagaacgg
atttcagttagagaaactgacatcggtaagcaactcacttgccaggtccaagctctcaaa
gccttgattgaagcttatcaagctgggctgattggggaggaaatagaatag

DBGET integrated database retrieval system