KEGG   Aerococcus urinae: HMPREF9243_0328Help
Entry
HMPREF9243_0328   CDS       T01447                                 

Definition
type III restriction enzyme, res subunit
Orthology
K01156  
type III restriction enzyme [EC:3.1.21.5]
Organism
aur  Aerococcus urinae
Brite
Enzymes [BR:aur01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.21  Endodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.21.5  type III site-specific deoxyribonuclease
     HMPREF9243_0328
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
316599..319574
Genome map
AA seq 991 aa AA seqDB search
MKIQFEDLDYQRQAIDSILHVFDGHKARQSNFTIGGSYAQYHLLNEYGVSNQIIFNPNRL
LDNVQQIQIANQLPLTERVPAGFPQFNIEMETGTGKTFVYLKSILEMNQKYGFTKFIIVV
PSIAIKEGVFKSIEMTRETFKKTMNGMIYRAFMYDSSKLENVGGFARNETVEIMVINIQS
FSKRGKANDNLNIIYRDDMDSMNGIRPIDLIAETNPVVIIDEPQSVDNTENAKEAIAALN
PSVAFRFSATHKQEFPLLYKLGPVEAYQKELVKQIEVAGFSEDIDPNEAYFKLVDIKATK
KTISATVEMNVRTKNGVEHKQNVKLKQDDDLYLKSKRLEPYESLGFVRAISAEPGNEYIE
LSGGKEIYRLDEAERDDRLLKRAQIQKTIEEHLDKELQLNPKGIKVLSLFFIDQVDKYRQ
YDENNEAIKGEYARIFEEEYRALIQREKYQSLRDREVPVEEVHDGYFAVDSKQRIKNTGG
ASKDDESAYQIIMKDKEDLLTFYDEKKGNTKRANKLRFIFSHSALKEGWDNPNVFQICTL
VETKDTLTKRQKIGRGLRIAVNQEGERAPGFETNVLTVMANESYQQFATDLQQEYESEGV
QFGLFTDNIFSSLIVEERADGTKSALGLEKSQLLVQYMQDEGYIDKKRKGTEKLAQDLKD
QSFKVPKEIAQLATGMSNRVIQAIEEKFNSDKVEVKDRRKRVSVKLNKQALTGPFLDLWR
RINEKTRYSISFDSERFIKEVSNELSLELQVKRRRIDYSKAQVGIAEAGIDFVEEESGAY
SSVDKVYTEVPDILTYLQNETRLTRQTIIKILKKSDTLRDFKRNPQEYMTEVARIINAHK
RVVMVDGIKYEKIGETYDQSLLKADEIDQYEDNTLKVHDDRYPYNYVVYDSNIERNFALE
CERDRNVKCYIKLPSNFKVPTPLGNYNPDWAVLIEQDEEDKLYFVVETKGTTDPTQLRSA
ELAKIKCGRKHFEVLDSGLAFKVSTNFKGLY
NT seq 2976 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattcaatttgaagacttggactaccaaagacaggcgattgattccattcttcat
gtttttgatgggcacaaggctcggcaatcaaattttacgattggaggaagctatgctcaa
taccatctcttaaatgagtatggggtcagcaatcagattatttttaatcctaatcgttta
cttgacaatgtccagcagatccagattgccaaccagcttcctctaactgagcgggtaccc
gctggctttccccaatttaatattgaaatggaaactggaacgggaaagacctttgtttat
ttgaaatctatcttggagatgaatcagaaatatggatttaccaaatttattattgtagtc
ccttcaattgcaataaaggagggggtctttaagtccattgagatgacgcgtgagaccttc
aagaagacgatgaatgggatgatctaccgggccttcatgtatgattcaagtaaactagag
aatgtgggtggcttcgctcgaaatgagaccgtagagatcatggtaattaacattcaatcc
ttctctaagcgtggaaaggcaaatgataatctaaatattatctaccgagatgatatggat
agtatgaatggaattcgtccgattgatctgattgcagagaccaatccagtggttattatt
gatgaacctcagagtgtggataatacggaaaatgccaaggaggcgattgcggctctgaac
ccttctgttgccttccgtttttcagccactcataagcaagaatttcccttgctttataaa
ttaggtcctgtggaagcttatcagaaagaattagtgaagcaaatcgaagtagctggtttt
agtgaggatatcgacccaaatgaagcatattttaaactggtcgatataaaggcgacaaag
aaaaccattagcgctacagtagaaatgaatgtgcggactaagaatggtgtcgaacataag
cagaatgttaaactcaagcaagatgacgacctctatctcaagtctaaacggctagagccc
tatgagtcactcggttttgtgcgggcaatttcagcagaacctggaaacgaatatattgaa
ttatctggcgggaaggaaatttatcgactagatgaagctgagcgagatgaccgattgctt
aaacgagctcagatccagaagacgatcgaagaacacctcgataaagagctacaattaaat
ccaaaaggaattaaggttctaagcctcttctttattgaccaggtagataagtatcgtcag
tatgatgagaataatgaagcgattaagggagaatatgctagaatttttgaagaagagtat
cgagctcttattcaaagagagaagtaccaaagcttaagagatcgtgaagtgccagtagaa
gaggttcatgatggttactttgcggtggattcaaagcaacggattaagaacacaggcggt
gcttctaaagatgatgaatctgcctatcaaattattatgaaggataaggaagacctgctc
accttctatgacgagaaaaaaggaaatactaaacgtgcgaataaattacgttttattttc
tcccattcagcgttgaaggaaggctgggacaatcccaatgtctttcagatctgtacttta
gtagaaactaaggatacgttgaccaaacgacaaaaaattggtcgtggcttaaggattgca
gtcaaccaagaaggcgaacgtgcaccaggttttgagaccaatgttttgactgttatggcc
aatgaaagttaccagcagtttgcgactgacttgcagcaagaatatgaaagtgaaggggtt
caatttggtctctttaccgataatatcttctcttctttaattgtggaagagcgtgctgac
ggaaccaaaagcgctttaggactagaaaaatctcaacttcttgtccagtatatgcaagat
gagggatatatagataagaagcgcaagggaacagagaaattagcccaagatcttaaggat
caaagtttcaaggttccaaaagaaattgcccaattagcaacaggcatgtctaatcgagtg
attcaggccattgaagagaagtttaattctgataaggttgaagtcaaggaccgacggaaa
cgggtatctgttaaactaaacaagcaggcattgacaggccccttccttgacttatggcga
cgtattaatgaaaaaacacgctattctatttcatttgattctgaacgctttattaaagaa
gtctctaatgaattatcgctcgagttacaggtgaaacgccgccgaatcgactattctaaa
gcccaagttgggattgctgaagcagggattgatttcgttgaagaagaatcaggagcttat
tcgagcgtagacaaggtatacacagaagtccctgatattttgacttatcttcagaatgaa
acacggttgacacggcaaacgattattaagatccttaagaaaagtgataccttgcgtgat
tttaagcggaaccctcaagaatatatgacagaagtcgctcgcattattaacgctcataaa
cgagtggtaatggtagacggcattaaatatgaaaaaataggagagacctacgatcaaagt
ttgctgaaagctgatgaaattgaccagtatgaagataatacactaaaagtacatgatgat
cgctatccttataattatgttgtttatgattcaaatattgagcgtaattttgccttggaa
tgtgagcgagacaggaacgtgaagtgttacatcaaattaccgagtaactttaaagttcca
acaccactaggtaactacaatcccgattgggcggtcttgatagagcaggatgaagaagat
aagttatactttgtggtagaaactaagggaacaaccgaccccactcaattgcgttcagca
gaacttgctaaaattaaatgtggccgtaagcattttgaagtattagattcgggattagct
ttcaaagtgtctactaactttaagggactttattga

DBGET integrated database retrieval system