KEGG   Aerococcus urinae ACS-120-V-Col10a: HMPREF9243_0345Help
Entry
HMPREF9243_0345   CDS       T01447                                 

Gene name
galU
Definition
(GenBank) UTP--glucose-1-phosphate uridylyltransferase
  KO
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
aur  Aerococcus urinae ACS-120-V-Col10a
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of antibiotics
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:aur00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    HMPREF9243_0345 (galU)
   00052 Galactose metabolism
    HMPREF9243_0345 (galU)
   00500 Starch and sucrose metabolism
    HMPREF9243_0345 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    HMPREF9243_0345 (galU)
Enzymes [BR:aur01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     HMPREF9243_0345 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
336952..337827
Genome map
AA seq 291 aa AA seqDB search
MTKVRKAIIPAAGLGTRFLPATKAMAKEMLPIVDKPTIQFIVEEALASGIEDILIITGKN
KRPIEDHFDSNIELEENLHAKGKDDLLEIVQETIGLNLFFKRQSYPKGLGDAVLQAKAFV
GDEPFVVMLGDDLMEDAVPLTKQLIDAYHETHASNIAVMRVPHEDTSKYGIIDPEAQYKD
GIYNVRQFVEKPDPSEAPSDLAIIGRYLLTPEIFDLLETQEPGAGNEIQLTDAIDRLNKT
QRVFALEFTGQRYDVGNKLEYMKTCISYGLRHPEIKDDLRAYLLDLEKDLK
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atgacgaaagtaagaaaagccattatccctgcagctggtttaggaacccgtttcttgcca
gccaccaaggccatggccaaagaaatgttaccaattgttgataaacccaccatccaattc
atcgtggaagaggccctggccagtgggattgaagatattttaatcattactgggaagaac
aaacgccccatcgaggaccactttgactccaatattgaactggaagaaaacctccatgcc
aagggtaaggacgacttactggaaattgtccaagagactattggcttaaacctcttcttc
aagcgccaatcctatcccaagggactgggagacgcggttttacaggccaaggcctttgtt
ggcgatgaaccctttgtggtcatgcttggcgatgatttgatggaggatgcagttcctttg
acaaaacaattgatcgacgcttatcatgaaacccatgcctctaatattgccgttatgcgg
gtgccccacgaagataccagcaagtacggcattatcgatccggaagcccaatataaggac
ggcatctataatgttcgccaattcgtggaaaaacctgatcctagcgaagcgccgagtgac
ttggctattatcggtcgttatctcctcactccagaaatctttgacctcttggaaacccaa
gaacctggggccggaaacgaaatccaattgaccgatgccattgaccgtctgaataaaaca
caacgggtctttgcccttgagtttaccggccaacgctatgatgtcggcaataagttagaa
tatatgaaaacctgtatttcctatggtctccgccatccagaaatcaaagacgacttacgc
gcctacctacttgacttagagaaggacttgaaataa

DBGET integrated database retrieval system