KEGG   Aerococcus urinae ACS-120-V-Col10a: HMPREF9243_0345Help
Entry
HMPREF9243_0345   CDS       T01447                                 

Gene name
galU
Definition
(GenBank) UTP--glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
aur  Aerococcus urinae ACS-120-V-Col10a
Pathway
aur00040  Pentose and glucuronate interconversions
aur00052  Galactose metabolism
aur00500  Starch and sucrose metabolism
aur00520  Amino sugar and nucleotide sugar metabolism
aur01100  Metabolic pathways
aur01130  Biosynthesis of antibiotics
Module
aur_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:aur00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    HMPREF9243_0345 (galU)
   00052 Galactose metabolism
    HMPREF9243_0345 (galU)
   00500 Starch and sucrose metabolism
    HMPREF9243_0345 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    HMPREF9243_0345 (galU)
Enzymes [BR:aur01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     HMPREF9243_0345 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 IspD
Motif
Other DBs
NCBI-ProteinID: AEA00325
UniProt: F2I6X2
Position
336952..337827
Genome map
AA seq 291 aa AA seqDB search
MTKVRKAIIPAAGLGTRFLPATKAMAKEMLPIVDKPTIQFIVEEALASGIEDILIITGKN
KRPIEDHFDSNIELEENLHAKGKDDLLEIVQETIGLNLFFKRQSYPKGLGDAVLQAKAFV
GDEPFVVMLGDDLMEDAVPLTKQLIDAYHETHASNIAVMRVPHEDTSKYGIIDPEAQYKD
GIYNVRQFVEKPDPSEAPSDLAIIGRYLLTPEIFDLLETQEPGAGNEIQLTDAIDRLNKT
QRVFALEFTGQRYDVGNKLEYMKTCISYGLRHPEIKDDLRAYLLDLEKDLK
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atgacgaaagtaagaaaagccattatccctgcagctggtttaggaacccgtttcttgcca
gccaccaaggccatggccaaagaaatgttaccaattgttgataaacccaccatccaattc
atcgtggaagaggccctggccagtgggattgaagatattttaatcattactgggaagaac
aaacgccccatcgaggaccactttgactccaatattgaactggaagaaaacctccatgcc
aagggtaaggacgacttactggaaattgtccaagagactattggcttaaacctcttcttc
aagcgccaatcctatcccaagggactgggagacgcggttttacaggccaaggcctttgtt
ggcgatgaaccctttgtggtcatgcttggcgatgatttgatggaggatgcagttcctttg
acaaaacaattgatcgacgcttatcatgaaacccatgcctctaatattgccgttatgcgg
gtgccccacgaagataccagcaagtacggcattatcgatccggaagcccaatataaggac
ggcatctataatgttcgccaattcgtggaaaaacctgatcctagcgaagcgccgagtgac
ttggctattatcggtcgttatctcctcactccagaaatctttgacctcttggaaacccaa
gaacctggggccggaaacgaaatccaattgaccgatgccattgaccgtctgaataaaaca
caacgggtctttgcccttgagtttaccggccaacgctatgatgtcggcaataagttagaa
tatatgaaaacctgtatttcctatggtctccgccatccagaaatcaaagacgacttacgc
gcctacctacttgacttagagaaggacttgaaataa

DBGET integrated database retrieval system