KEGG   Aerococcus urinae: HMPREF9243_0367Help
Entry
HMPREF9243_0367   CDS       T01447                                 

Definition
putative 3-hydroxybutyrate dehydrogenase
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
aur  Aerococcus urinae
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aur00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    HMPREF9243_0367
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    HMPREF9243_0367
Enzymes [BR:aur01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     HMPREF9243_0367
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(367445..368203)
Genome map
AA seq 252 aa AA seqDB search
MANTNRVVVVTGGGSGIGLAIAKSFAENGDKVAILGRTKEKLDKAAEGHENLYGFPCDIQ
VEEEVQETTAAIAKELGDIDVLVNNAGLQRIHSVEDFPLSDWNQVIGTILTGTFLMTKYA
LPYMTKNEWGRVITISSGHGRRPDKYKSAYVAAKHGQIGFTNTVAMEYAQAGITANSILP
GATNTDLIQNQLGDLAEKDGTSKQEALETHILGAQWMKELIEPEEIGALAVFLASDGAAK
ITGEAIGITGGE
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atggcaaataccaatcgcgttgttgttgttactggtggcgggtcagggattggccttgct
atcgcaaaaagttttgcagaaaatggtgacaaggtagctatcctcggtcggaccaaggaa
aaattagacaaggctgctgaggggcatgaaaatctttacggcttcccttgtgacatccaa
gtcgaagaagaagttcaggaaaccaccgcagcgatcgccaaagaacttggtgacattgac
gtcttagtcaataatgctggtttacaaagaattcactctgtcgaagacttcccactttct
gactggaaccaagtgatcggcaccatcttaaccggaaccttcctcatgaccaaatatgcc
ctcccttacatgactaaaaacgaatggggccgggtcattaccatttcttccggtcatggt
cgtcgtccagataaatacaagtcagcttatgtagcggctaaacatggtcaaatcggtttc
accaataccgtagctatggaatacgcccaagctggcattaccgctaactctatcctacca
ggcgccaccaatactgatttaatccaaaatcaattaggtgacttagccgaaaaagacggc
acttctaaacaagaagccctggaaacccatatcttaggggctcaatggatgaaagaactc
attgaacctgaagaaatcggtgccttggcagtcttcttagcttctgacggtgccgctaag
attaccggcgaagccatcggcattaccggtggcgaatag

DBGET integrated database retrieval system