KEGG   Aerococcus urinae: HMPREF9243_0372Help
Entry
HMPREF9243_0372   CDS       T01447                                 

Gene name
gltX
Definition
glutamate--tRNA ligase (EC:6.1.1.17)
Orthology
K09698  
nondiscriminating glutamyl-tRNA synthetase [EC:6.1.1.24]
Organism
aur  Aerococcus urinae
Pathway
Aminoacyl-tRNA biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aur00001]
 Genetic Information Processing
  Translation
   00970 Aminoacyl-tRNA biosynthesis
    HMPREF9243_0372 (gltX)
Enzymes [BR:aur01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.24  glutamate---tRNAGln ligase
     HMPREF9243_0372 (gltX)
Amino acid related enzymes [BR:aur01007]
 Aminoacyl-tRNA synthetase
  Class I (A)
   HMPREF9243_0372 (gltX)
Transfer RNA biogenesis [BR:aur03016]
 Prokaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    HMPREF9243_0372 (gltX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
371645..373126
Genome map
AA seq 493 aa AA seqDB search
MSDKIRVRYAPSPTGYLHIGNARTALFNYLFARHEGGDFIIRIEDTDKKRNVADGEKSQI
DNLKWLGLDWDESPENPGQYGPYRQSERYDIYQKYIDQLIEQGDAYYAFDTEEELEAARQ
AQKEAGTMPHYEGTWRDRSDEDIQAARDEGRPETVRFRIPEGETYTFDDMVKGQVSIHSE
DIGGDFIIWKKDKSPTYNFAVVVDDHLMAITHVLRGDDHLSNTPKQIMIYQALGWEPPVF
GHMSLITSAETGKKLSKRDGSIIQFIEQYRALGYLPEAIFNFIALLGWSPKGEEEIFSKE
EFIEIFDPNRLSKSPAAFDNKKLEWINNRYMKAADEETVARLAIPHLQAAGRVSDDPSEE
ELAWTKKLVSLYKDEMSYAKQIVDLSDMFFHDSLEVDERGKEILSADTAYEVVNDFNNKL
DAIQPFDEEHIMATIKQVQKDTGIKGKNLYMPLRVATSGKEHGPSIGLTIEVMGKEKTKH
HLEEALSKMGKAE
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atgtccgataagatcagagtgcgctatgcgccaagtccaacaggctacttacacattggg
aatgcgcgtaccgctttgtttaactacttattcgcccgtcacgaaggtggcgacttcatt
atccgtattgaagacaccgataaaaaacggaatgtggctgatggtgaaaagagccaaatt
gacaacttgaaatggttaggtttggattgggacgaaagcccagaaaatccaggccaatac
ggtccttaccgccaatcagaacgttacgatatctaccaaaaatatattgaccaattgatc
gagcaaggcgatgcttactatgcctttgataccgaagaagaattagaagcagctcgccag
gctcaaaaggaagccggtaccatgcctcactatgaaggcacctggcgtgatcgttcggat
gaagacatccaagctgcccgagacgaagggcgtcctgaaaccgtccgtttccggattcca
gaaggggaaacctatacctttgatgacatggttaaaggtcaagtcagcatccattctgaa
gatattggaggcgactttattatctggaagaaagataagtctccaacctataacttcgct
gtggtggttgatgaccacttaatggcaattacccatgtcttacgtggagatgaccatttg
tctaatacgccaaaacaaatcatgatctaccaagcattaggctgggaaccaccagtattc
ggccacatgtccttgattaccagtgccgaaaccgggaagaaattgtccaagcgtgatggg
tccattattcaatttattgaacaataccgtgccctgggttacctccctgaagcgatcttt
aactttatcgccttactgggctggtcaccaaaaggggaagaagaaatcttctctaaggaa
gaatttatcgaaatctttgaccctaaccgcttaagcaagtcaccggcggcttttgataat
aagaaattggaatggatcaataaccgctacatgaaggcagccgacgaagaaaccgttgcc
cgccttgccattcctcacctgcaagcggctggtcgggtatcagacgaccccagtgaagaa
gaattggcttggaccaagaaattagtctccttatataaggatgaaatgtcctacgccaaa
caaattgtcgacttgtccgacatgttcttccacgattccctagaagtggacgaacgcggt
aaggaaatcttgtcagcggacaccgcctatgaagtggtcaatgactttaacaataagttg
gacgctatccaacctttcgatgaagaacacatcatggcgaccattaaacaagttcaaaaa
gacaccggcatcaagggtaaaaatctctacatgccactgcgtgtcgcgacttccggtaag
gaacacggtccgtccatcggcttaactattgaagtcatgggtaaggaaaagaccaaacac
catctcgaagaagccttaagtaagatgggaaaagctgaataa

DBGET integrated database retrieval system