KEGG   Aerococcus urinae: HMPREF9243_0372Help
Entry
HMPREF9243_0372   CDS       T01447                                 

Gene name
gltX
Definition
glutamate--tRNA ligase (EC:6.1.1.17)
Orthology
K09698  
nondiscriminating glutamyl-tRNA synthetase [EC:6.1.1.24]
Organism
aur  Aerococcus urinae
Pathway
Aminoacyl-tRNA biosynthesis
Metabolic pathways
Class
Genetic Information Processing; Translation; Aminoacyl-tRNA biosynthesis [PATH:aur00970]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
371645..373126
Genome map
AA seq 493 aa AA seqDB search
MSDKIRVRYAPSPTGYLHIGNARTALFNYLFARHEGGDFIIRIEDTDKKRNVADGEKSQI
DNLKWLGLDWDESPENPGQYGPYRQSERYDIYQKYIDQLIEQGDAYYAFDTEEELEAARQ
AQKEAGTMPHYEGTWRDRSDEDIQAARDEGRPETVRFRIPEGETYTFDDMVKGQVSIHSE
DIGGDFIIWKKDKSPTYNFAVVVDDHLMAITHVLRGDDHLSNTPKQIMIYQALGWEPPVF
GHMSLITSAETGKKLSKRDGSIIQFIEQYRALGYLPEAIFNFIALLGWSPKGEEEIFSKE
EFIEIFDPNRLSKSPAAFDNKKLEWINNRYMKAADEETVARLAIPHLQAAGRVSDDPSEE
ELAWTKKLVSLYKDEMSYAKQIVDLSDMFFHDSLEVDERGKEILSADTAYEVVNDFNNKL
DAIQPFDEEHIMATIKQVQKDTGIKGKNLYMPLRVATSGKEHGPSIGLTIEVMGKEKTKH
HLEEALSKMGKAE
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atgtccgataagatcagagtgcgctatgcgccaagtccaacaggctacttacacattggg
aatgcgcgtaccgctttgtttaactacttattcgcccgtcacgaaggtggcgacttcatt
atccgtattgaagacaccgataaaaaacggaatgtggctgatggtgaaaagagccaaatt
gacaacttgaaatggttaggtttggattgggacgaaagcccagaaaatccaggccaatac
ggtccttaccgccaatcagaacgttacgatatctaccaaaaatatattgaccaattgatc
gagcaaggcgatgcttactatgcctttgataccgaagaagaattagaagcagctcgccag
gctcaaaaggaagccggtaccatgcctcactatgaaggcacctggcgtgatcgttcggat
gaagacatccaagctgcccgagacgaagggcgtcctgaaaccgtccgtttccggattcca
gaaggggaaacctatacctttgatgacatggttaaaggtcaagtcagcatccattctgaa
gatattggaggcgactttattatctggaagaaagataagtctccaacctataacttcgct
gtggtggttgatgaccacttaatggcaattacccatgtcttacgtggagatgaccatttg
tctaatacgccaaaacaaatcatgatctaccaagcattaggctgggaaccaccagtattc
ggccacatgtccttgattaccagtgccgaaaccgggaagaaattgtccaagcgtgatggg
tccattattcaatttattgaacaataccgtgccctgggttacctccctgaagcgatcttt
aactttatcgccttactgggctggtcaccaaaaggggaagaagaaatcttctctaaggaa
gaatttatcgaaatctttgaccctaaccgcttaagcaagtcaccggcggcttttgataat
aagaaattggaatggatcaataaccgctacatgaaggcagccgacgaagaaaccgttgcc
cgccttgccattcctcacctgcaagcggctggtcgggtatcagacgaccccagtgaagaa
gaattggcttggaccaagaaattagtctccttatataaggatgaaatgtcctacgccaaa
caaattgtcgacttgtccgacatgttcttccacgattccctagaagtggacgaacgcggt
aaggaaatcttgtcagcggacaccgcctatgaagtggtcaatgactttaacaataagttg
gacgctatccaacctttcgatgaagaacacatcatggcgaccattaaacaagttcaaaaa
gacaccggcatcaagggtaaaaatctctacatgccactgcgtgtcgcgacttccggtaag
gaacacggtccgtccatcggcttaactattgaagtcatgggtaaggaaaagaccaaacac
catctcgaagaagccttaagtaagatgggaaaagctgaataa

DBGET integrated database retrieval system