KEGG   Aerococcus urinae: HMPREF9243_0665Help
Entry
HMPREF9243_0665   CDS       T01447                                 

Gene name
leuS
Definition
leucine--tRNA ligase (EC:6.1.1.4)
Orthology
K01869  
leucyl-tRNA synthetase [EC:6.1.1.4]
Organism
aur  Aerococcus urinae
Pathway
Aminoacyl-tRNA biosynthesis
Class
Genetic Information Processing; Translation; Aminoacyl-tRNA biosynthesis [PATH:aur00970]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
669108..671522
Genome map
AA seq 804 aa AA seqDB search
MAYNHKTIEKKWQKYWKDNKSFKTLEDKSLPKFYALDMFPYPSGQGLHVGHPEGYTATDI
VSRMKRAQGYNVLHPMGWDAFGLPAEQYALDTGNDPAEFTQANIEVFKKQIESLGFSYDW
DREIDTTDPEYYKWTQWIFTKLFEKGLAYEDEIMVNWCEALGTVLANEEVIDGLSERGNH
PVVRRPMKQWVLKITAYADRLLDGLDDLDWPESIKEMQRNWIGRSEGADVTFKVADTDKE
FEVFTTRPDTLYGATYCALAPEHPLIKQIVSEDQKQAVADYVEAASHKSDLERTDLAKEK
TGVFTGAYAVNPLNGDKLPIWVADYVLVSYGSGAVMAVPAHDQRDYEFAKQFDLPIKAVI
EGGDLEKEAYTGDEVHIHSEELDGLVKDEAIEKAIELLEAKGAGQAKTSYRLRDWVFSRQ
RYWGEPIPVIHWEDGTTTAVPEADLPVLLPEGKDIKPSGTGESPLANFDDWLNVYDEETG
LHGKRETNTMPQWAGSSWYYIRFCDPKNNEELISQEAANYWMNVDLYIGGAEHAVLHLLY
ARFWNMFLYDLGVVPTEEPFQKLFNQGMILGEGHEKMSKSKGNVVNPDDIVERYGADTLR
LYEMFMGPLDASIAWSEDGLAGARRFLERVWRLFVDSEDQLRDRITTIDTGELDKVYNQT
VKKVTEDLEKLHFNTAISQMMVFVNEANKAESIPYDYAKGFVQLLAPIAPHLGEELWQRL
TGEAGISYVPWPSYDESQLVEESIEIVVQVNGKIKERLQVASGLSQEELSQAAKDSDKVQ
AAIAGKDVVKVIAVPDKLVNIVVK
NT seq 2415 nt NT seq  +upstreamnt  +downstreamnt
atggcttataaccacaagacgatagagaaaaaatggcaaaaatattggaaagacaataag
agctttaaaaccttagaggacaagtccttgcctaagttttatgcattggatatgttcccc
tatccttctggtcaagggctccatgtggggcacccagaaggttatacagcaaccgatatt
gtttcgagaatgaagcgggcccaaggttataatgttctccatcctatgggttgggacgcg
tttggtttgccagcggaacaatatgccctcgataccggtaatgaccccgccgaatttacc
caagccaatatcgaggtcttcaagaaacaaattgaatccctcggtttttcctatgactgg
gaccgtgaaattgacaccactgatccagaatattataagtggacccaatggatcttcacc
aaactctttgaaaagggtctagcctatgaagatgaaatcatggttaactggtgtgaagcc
ttggggacggttctggctaatgaagaagtgattgacggcttgtctgaacggggcaatcat
cctgtggttcggcgtccgatgaagcaatgggtattgaagattaccgcctatgctgatcgg
cttttagatggtttagatgacttggattggccagaaagcattaaggaaatgcaacggaac
tggattggtcgttctgaaggggccgatgtgacctttaaggtggctgatactgacaaagag
tttgaagtctttaccactcgtcctgataccctttacggagctacctactgtgccttagcc
ccagaacacccactgatcaaacaaattgtcagcgaagatcaaaagcaagcggtggctgac
tatgttgaagctgccagccataagtctgacttagaacgtaccgatctcgctaaggagaag
actggggtatttactggggcttatgcggttaacccactcaacggggacaagctccctatc
tgggtggctgactatgtcttggtttcttatgggagcggtgccgttatggctgttcctgcc
catgaccaaagggactacgaatttgctaagcaatttgaccttccaattaaagccgttatc
gaaggcggcgacctggaaaaagaagcctacactggcgatgaggtccacattcattcagaa
gaattggatggcctggttaaggatgaagccattgaaaaggctattgaactcttagaggct
aagggagctggccaagccaagacctcctaccgtctccgcgactgggttttctctcgccaa
cgctactggggggaacctattcctgtcatccattgggaagatgggaccactacagccgtt
cctgaagcagacttaccagtgctcttacctgagggcaaagatattaaaccttctggtacc
ggagaatctcctctggctaactttgatgattggctcaatgtctatgatgaagaaacaggt
ctccacggtaaacgtgaaaccaatactatgccacaatgggcaggatccagctggtactat
attcgcttctgtgatcctaagaataatgaagaactcattagccaagaagccgctaactat
tggatgaatgttgacttatatatcggtggggcagaacacgccgtgcttcacctcctctac
gcccgtttttggaatatgttcctctatgatttaggtgttgttcccacagaagagcctttc
caaaaactctttaaccaaggaatgattcttggcgaaggtcacgaaaagatgtctaaatca
aagggcaatgtggtcaaccctgatgacattgttgaacgttacggggcagacaccttacgt
ttgtatgagatgtttatgggacctctggatgcctcaattgcctggagtgaagatggctta
gcgggggctagacgcttcctagaaagagtctggcgtctatttgtggatagcgaagaccaa
ttacgggaccgcatcactactatcgataccggtgaattagataaagtctataaccaaact
gtcaagaaagtcactgaagacctggaaaaattacactttaatacagctatttcgcaaatg
atggtctttgttaatgaagcgaataaggctgaaagtattccttacgattatgccaagggc
tttgtccaattactggctccaattgctcctcacttgggagaagaattgtggcaacgtcta
actggtgaagctggaatttcatatgtgccatggccaagttacgacgaaagccaattggtc
gaagaaagtatcgaaattgttgttcaagtgaacggtaagatcaaggaacgtctccaagtg
gctagtggccttagccaagaggaattgagtcaagcagccaaagactctgacaaggtccaa
gctgccattgctggtaaggacgttgtgaaggtgattgctgttccagataaattggttaat
attgtggtcaaatag

DBGET integrated database retrieval system