KEGG   Aerococcus urinae ACS-120-V-Col10a: HMPREF9243_0734Help
Entry
HMPREF9243_0734   CDS       T01447                                 

Definition
(GenBank) phosphoglycerate mutase 1 family
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
aur  Aerococcus urinae ACS-120-V-Col10a
Pathway
aur00010  Glycolysis / Gluconeogenesis
aur00260  Glycine, serine and threonine metabolism
aur00680  Methane metabolism
aur01100  Metabolic pathways
aur01110  Biosynthesis of secondary metabolites
aur01120  Microbial metabolism in diverse environments
aur01130  Biosynthesis of antibiotics
aur01200  Carbon metabolism
aur01230  Biosynthesis of amino acids
Module
aur_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
aur_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:aur00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HMPREF9243_0734
  Energy metabolism
   00680 Methane metabolism
    HMPREF9243_0734
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HMPREF9243_0734
Enzymes [BR:aur01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     HMPREF9243_0734
Membrane trafficking [BR:aur04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    HMPREF9243_0734
Exosome [BR:aur04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   HMPREF9243_0734
  Exosomal proteins of melanoma cells
   HMPREF9243_0734
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: AEA01556
UniProt: F2I8Y2
Position
complement(745328..746005)
Genome map
AA seq 225 aa AA seqDB search
MKLVFIRHGESELNLANVFTGWLDPKLSENGRKEAAKAGQDLKETGIEFDSVHTSVLTRA
IQTCNIVLEEMDRLYLPVEKNWRLNERHYGGLQGLNKAETAEKYGDEQVHIWRRSYDVRP
PQASGEQAFDHRYDHLDTRHMLAGECLKDTLDRTLPYWEDHIAPELKDGKNVLVVAHGNS
LRSLTKHIENISDDDIMGVEIATGEPIVYDIDENLNVVNKTVLHK
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atgaaattagtattcattcgtcacggtgaaagtgaattaaacttagccaatgtctttacc
ggttggttagatccaaaattaagtgaaaacggtcgtaaggaagcggctaaagcgggtcaa
gatttaaaagaaacgggtattgaatttgattctgttcatacttccgtactaacccgcgct
atccaaacctgtaacattgttttagaagaaatggaccgcctctacctaccagtagaaaaa
aattggcgtttaaatgaacgtcactatggtggtttacaaggtttaaacaaagctgaaacc
gctgaaaaatatggtgatgaacaagttcatatctggcgtcgttcctacgatgtacgtcct
ccacaagctagcggtgaacaagcctttgaccatcgttatgaccacttagacacccgccac
atgcttgctggtgaatgtctaaaggatacccttgaccgtacccttccttactgggaagac
cacattgctccagaattaaaagacggcaaaaatgttttagttgtggctcacggtaacagc
ttacgttccctaaccaaacacattgaaaacatttctgacgatgacatcatgggcgttgaa
atcgcaactggcgaaccaatcgtttatgacatcgacgaaaacctcaatgttgtgaacaag
acagttttacataaataa

DBGET integrated database retrieval system