KEGG   Aerococcus urinae: HMPREF9243_0913Help
Entry
HMPREF9243_0913   CDS       T01447                                 

Gene name
xfp
Definition
D-xylulose 5-phosphate/D-fructose 6-phosphate phosphoketolase (EC:4.1.2.22)
Orthology
K01621  
phosphoketolase [EC:4.1.2.9]
Organism
aur  Aerococcus urinae
Pathway
Pentose phosphate pathway
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aur00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    HMPREF9243_0913 (xfp)
Enzymes [BR:aur01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.9  phosphoketolase
     HMPREF9243_0913 (xfp)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
930047..932416
Genome map
AA seq 789 aa AA seqDB search
MTDFDSKAYLDKVDAWWRAANYLSVGQMYLRDNPLLDREVTADDIKITPIGHWGTIAGQN
FVYAHLNRVINKYDLNMFYIEGPGHGGQVMQANAYLDGTWTEHYPEYPQNKEGMQKFFKY
FSFPGGTGSHATAEIPGSIHEGGELGYSLSHATGAILDNPDVIAATVIGDGESETGPLAA
SWLSNSFINPVTDGAVLPILYLNGGKIANPTILERKSNEDLIKYFQGLGWDPMVVEGNDP
EKVHPLMAKTLDQAIEKIKSIQGEARKGSADEATMGHWPMILYRTPKGWTGPKAWEGNDI
EGSFRAHQVPIPVNAENMEHVDALIDWLKSYRPEELFTEEGQLRPEIAEIAPKGDQRMAS
NPITDGGIDPKPLDLPDWRDYALDFETPGERDAQDMIEMGGYAAGVIEKNPDNFRIFGPD
ETKSNRLNKVFNVTKRQWLEPIKDNYDEWMSPSGRVIDSQLSEHQMEGFLEAYTLTGRHG
FFASYEAFIRTVDSMITQHFKWMREASEYKWHKPYQSLNLISSSTAFQQDHNGYTHQDPG
LLTHLAEKKGEFVRAYLPADTNSLLAVMDKALSSENVINYIVTSKHPRPQFFSVEEAEEF
VDKGYKVIDWASTVEEGEEPDVVIAASGTEPTVETIATISYLHEAFPELKIRYVNVVDLY
RLRHPNIDPRGLSDEEFDAVFTKDKPVFFGFHSFEGLLKDIFFDRHNHNLYPHGYREEGA
ITTPFDMRVLNELDRFHFAAHVAEVVYGDKAQDFIDQMNAKVEEHRAYIVEYGTDMPEVK
EWKWQPLEK
NT seq 2370 nt NT seq  +upstreamnt  +downstreamnt
atgactgattttgattcaaaagcgtatttagataaagtggatgcctggtggcgtgccgct
aattatttatctgtgggacaaatgtatttacgggataatcctttattagaccgcgaagta
actgcagatgacatcaagatcaccccaattggacactggggaactattgctgggcaaaac
tttgtttatgcgcacttgaaccgtgtgatcaataaatatgacctaaacatgttctatatc
gaaggaccaggacacggtggtcaagtcatgcaagctaacgcctatttagacggcacttgg
actgaacactatccagaatacccacaaaacaaggaaggtatgcaaaaattcttcaaatac
ttctccttcccaggcggaactggctcccatgccactgctgaaatccctggctctatccat
gaaggtggagaattaggttattccttatctcatgcaactggtgctattcttgataaccca
gatgtgatcgctgccactgtgattggtgacggggaatctgaaactggtccgttagcagct
agctggttatctaacagcttcattaacccagtgactgacggtgcagtcttaccaatcctt
tacttaaacgggggtaaaattgctaacccaaccatcttagaacgtaaatccaatgaagac
ttgattaagtacttccaaggattaggttgggatccaatggtggttgaaggaaacgatcct
gagaaggttcacccactcatggctaaaaccttagaccaagccattgaaaagattaaatcc
atccaaggcgaagcacgtaagggttcagctgacgaagcaaccatgggtcactggccaatg
attctttaccggacacctaagggctggactggtcctaaggcatgggaaggtaacgacatt
gaaggttctttccgggctcaccaagtgccaatcccagtgaacgctgaaaacatggaacac
gtggatgccttaattgactggttgaaatcctatcgtccagaagaactctttactgaagag
ggtcaattacgtccagaaattgctgaaattgcacctaagggtgaccaacggatggcttct
aacccaattactgacggaggcatcgatcctaaacctttagacttaccagactggcgtgac
tatgctcttgactttgaaacacctggtgaacgcgatgcccaagacatgattgaaatgggt
ggctatgcagctggcgttatcgaaaagaacccagacaacttccgtatctttgggccagac
gaaaccaagtctaaccgcttgaacaaggtcttcaacgtcaccaaacgtcaatggttagaa
ccaatcaaggataactacgatgaatggatgtcaccatctggtcgtgtgattgactcacaa
ttgtcagaacaccaaatggaaggtttcctagaagcttataccttaaccggtcgccatggt
ttctttgctagttatgaagccttcatacggacagttgactccatgatcacccaacatttc
aaatggatgcgtgaagctagcgaatacaaatggcataaaccatatcaatcattgaacttg
atttcttcttctaccgctttccaacaagaccataacggttatactcaccaagacccaggt
ttattaacccacttggcagagaagaagggtgaatttgtacgggcttatctccctgcagat
accaactccctcttagctgtgatggataaggctttaagttcagaaaacgtgattaactac
atcgtgacttctaaacacccacgtccacaattcttctcagttgaagaagctgaagaattt
gttgacaagggctacaaggtcatcgactgggcttctaccgttgaagaaggggaagaacct
gacgtagtgatcgctgcatctggtactgaaccaacagtagaaaccattgcaaccatttca
tacctacacgaagccttcccagaattgaagattcgttacgtgaatgtggttgatctctac
cgtctccgtcatccaaatattgacccacgtggcttatctgacgaagaatttgatgctgtc
tttactaaagacaaaccagtcttctttggcttccacagcttcgaaggcttactcaaagac
attttcttcgaccgtcacaatcataacctctacccacatggttaccgtgaagaaggggcc
attaccacaccatttgacatgcgtgtcttaaacgaactcgaccgcttccactttgcggct
catgttgctgaagtggtatacggcgataaagcccaagacttcattgaccaaatgaatgct
aaggtggaagaacaccgtgcctacattgtagaatacggtactgatatgccagaagttaaa
gaatggaaatggcaaccacttgaaaaatag

DBGET integrated database retrieval system