KEGG   Aerococcus urinae: HMPREF9243_0954Help
Entry
HMPREF9243_0954   CDS       T01447                                 

Gene name
glpK
Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
aur  Aerococcus urinae
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:aur00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
988234..989745
Genome map
AA seq 503 aa AA seqDB search
MEEYILAIDQGTTSTRAVIYNHQGESIGSYQKEFDQIFPKPGWVEHNANQIWNSVQSVIA
GAFIETGIKPRQIKGIGITNQRETTVIWDKETGRPIYNAIVWQSRQTSSIADQLIADGHK
DMIQEKTGLVVDPYFSATKIRWILDQVDGAQERAENGELLFGTIDTWIVWKLTDGAVHVT
DYSNASRTMLFNVKDLEWDQEILDLLNIPRELLPEVKSNSEVYGKTIPFHFYGAEVPIAG
MAGDQQAALFGQLALEPGMVKNTYGTGAFIIMNMGSDFQVSENNLLTTIAYGMNGEVTYA
LEGSIFVAGSAIQWLRDQMGLIEDSPQSEDLAKQSKDDDEVYVVPAFTGLGAPHWDSRAR
GAVFGLTRGTNRNDFVKATLQSLAYQTRDIIDTMEVDTGIDINLLKVDGGAAMNDYLMQF
QADILGIEIARAKNLETTALGAAYLAGLAVDFWKNTDELKSLQSTGQNFTPSMNNAHKEQ
LYRGWKQAVKATRVFTADEEERD
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atggaagaatacattttagcaatagaccagggaacaacaagtacacgagctgtgatttat
aatcaccaaggggaaagtatcggttcctatcaaaaggagtttgaccaaatctttcctaag
cctggttgggtggaacacaatgccaatcaaatttggaactctgtccagtcagtcattgcc
ggagcctttattgagacgggaattaagccgcgtcaaatcaaaggaattgggataaccaat
caacgggaaacgacggtaatttgggacaaggaaactgggcgtcctatttataacgccatt
gtctggcaatcgcgtcaaactagcagtatagctgaccaactcatcgctgatggccataaa
gacatgattcaagagaaaacaggtttggtggttgacccttatttttcagcgactaaaatt
cgttggatcttagaccaggtcgatggcgctcaagagcgagcagaaaatggagaattactc
tttgggaccattgatacatggatcgtctggaagttaaccgacggtgctgtccatgtgacg
gattattcgaacgctagtcggacgatgttgttcaacgttaaggatttagaatgggaccag
gaaatcttagacttattaaatatcccgcgtgaactcctgcctgaagtcaaatccaattca
gaagtttacggcaaaacgattcctttccacttttatggtgcggaggttccgattgctgga
atggcgggggaccaacaagctgccttgtttggtcaacttgctttagagccaggtatggtg
aaaaatacctacggcacgggtgcctttatcattatgaatatggggtctgattttcaagtc
tcagagaacaatctgttgaccactatcgcctacggaatgaatggagaagtcacttatgcc
ctagaagggtcgatttttgtggccggctcagcgatccaatggctcagagaccaaatgggt
ttgattgaggactcccctcagtcagaagacctggctaaacaatctaaagatgatgatgag
gtttatgtggttcccgcctttactggcctcggagcaccccactgggattccagggcacgg
ggagccgtatttggtctcactcggggaacgaaccgcaatgactttgttaaggcaactttg
cagtctttagcctatcagactcgggatattatcgataccatggaagtagatacaggtatt
gatattaacctattaaaagtggatggcggagctgctatgaacgattatctcatgcaattc
caagcggatattctaggtattgaaattgctcgggctaaaaacctagaaactactgcctta
ggtgccgcatatttagctggcttagcagtggacttttggaaaaatactgatgaattgaag
agcttacaaagtactggacaaaactttaccccttcaatgaataatgcccataaagaacaa
ctttatcgtggttggaaacaggcagtgaaagccacccgggtctttacagcagatgaagaa
gaaagagactaa

DBGET integrated database retrieval system