KEGG   Aerococcus urinae: HMPREF9243_0955Help
Entry
HMPREF9243_0955   CDS       T01447                                 

Definition
FAD dependent oxidoreductase
Orthology
K00105  
alpha-glycerophosphate oxidase [EC:1.1.3.21]
Organism
aur  Aerococcus urinae
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:aur00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    HMPREF9243_0955
Enzymes [BR:aur01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.3  With oxygen as acceptor
    1.1.3.21  glycerol-3-phosphate oxidase
     HMPREF9243_0955
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
989770..991608
Genome map
AA seq 612 aa AA seqDB search
MTFSVKNRQQALTKLQERTLDLLVIGGGITGAGVALQAAASGLETGLIEMQDFAEGTSSR
STKLVHGGIRYLKNFDVEVVADTVSERAVVQQIAPHIPKPDPMVIPIYDEEGATFTMFRL
KVAMDLYDSLAGVSDSSYANTVLSKEEVLQHVPGLKEEGLQGGGQYLDFNNSDIRLVIEN
IKRAHQDGALVASRVEAIGYLYDQEGKINGVKALDHLSNESFDIHARYVINTTGPWSDET
RNLDEEDNRIEMMRPTKGIHLVIDASRLKVSQPVYFDSGYDDGRMIFVIPREDKTYFGTT
DTDYTGDYKHPQVEEDDVNYLIGAVNNRFPEAKISIDDIESSWAGLRPLIAGNSASDYNG
GDSGKINDQSFEDLIAVVKGYLNEEKTRDQVERTVANLEGSLSEETLDPSQVSRGSSLER
DDNGLITLAGGKITDYRKMAAGAMEKIIKLLKEEYDKSFRLINSKTYPVSGGEINPANIE
GEFSSYAQMGVKRGLSKEEAYYLAAFYGSNVPKVYALIDQVPEIEGLSLAETIMLYYALE
EEMVLTPVDYFLRRTNYMLFMRDRLDHLLEPVVQAMSDYFDWDDQSRQAYQKELEEALAK
NDLVDLKKKANG
NT seq 1839 nt NT seq  +upstreamnt  +downstreamnt
atgacattttctgttaaaaatagacaacaagctctgaccaaattacaagaacgtacccta
gatttattggttattggtggcggaattactggagcaggggtagccttgcaagcagcagcg
agtggtttagaaaccggtttaatcgaaatgcaagattttgcggaaggcaccagtagtcgg
tccaccaagctagtccacggtggtatccgctatttaaaaaactttgatgtggaagtggtt
gccgatacggttagtgaacgggcagtcgttcaacaaattgcccctcacattcctaaacct
gacccgatggttattcccatctacgatgaagagggcgctacttttaccatgtttcgcttg
aaagtagctatggacctctatgattccttagctggggtgagcgattctagctatgccaat
accgttctatccaaagaagaagttctccaacatgtgccaggtttaaaagaagaaggctta
caaggtgggggccaatatctagactttaacaatagcgatatccgtttagtgattgaaaat
attaaaagagcccaccaagatggtgccctagtggctagtcgagtagaagcgatcggctat
ctttacgaccaagagggcaagatcaatggcgtaaaggcactggatcacttaagtaatgaa
agctttgatattcatgcccgctatgtcattaatacgaccggaccatggagtgatgaaacc
cgcaatctcgatgaagaagacaaccgtatcgaaatgatgcgtcctactaaagggattcac
ctggttatcgatgccagccgcctaaaagtcagtcagcctgtttactttgattcgggttat
gatgacggacggatgatctttgtcatcccgcgggaagataagacctattttgggacgact
gataccgactacacaggcgattacaaacatcctcaagtagaagaagatgatgttaactat
ctcataggtgctgtcaacaaccgcttccctgaggctaagataagcatcgatgatattgag
tcctcctgggccggtttaagacccctaatcgctggcaacagtgcctctgactataatggt
ggagactcaggtaaaattaatgaccaaagctttgaggatttaattgctgtggttaagggt
tacttaaatgaagaaaaaacacgagaccaagtggaacgtactgtcgctaacttggaaggt
tctctatcagaagaaactctagacccttctcaagtatcacgggggtctagtctagaacgt
gatgataacggactaattaccctagccggtggaaagattaccgactaccgtaagatggct
gccggggctatggaaaaaattattaagctcctcaaagaggaatacgataaatccttccgc
ctaattaattcaaaaacctatcctgtttctggtggggaaattaatccggctaatatcgaa
ggtgagttctcctcttatgctcaaatgggggtaaaaagaggtttatctaaggaagaagct
tattatctagcagccttttacggatctaatgtgcctaaggtatatgccttaattgaccaa
gtgccagagattgaaggcttgtctttagctgaaaccatcatgctctactacgctttagaa
gaggaaatggttcttacccctgttgattactttttacgtcggaccaactacatgctcttt
atgcgtgaccgcttagaccacttacttgaaccagtcgttcaagccatgagtgattatttt
gactgggatgatcaaagtcgtcaagcttaccaaaaggaattagaagaagcactggccaaa
aatgacctagttgacttaaagaagaaggctaatggctaa

DBGET integrated database retrieval system