KEGG   Aerococcus urinae: HMPREF9243_0964Help
Entry
HMPREF9243_0964   CDS       T01447                                 

Definition
helicase, RecD/TraA family
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
aur  Aerococcus urinae
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:aur00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    HMPREF9243_0964
Enzymes [BR:aur01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     HMPREF9243_0964
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
997856..1000321
Genome map
AA seq 821 aa AA seqDB search
MAATEDYFIGEVEATFFSNPDNYYRVMRITVDDTNTLYSEKNIVVTGNFGTIQDGTTYQF
FGNLVDHPKYGVQFKVSHYEGIKITSKDGLIKYLSSDEFPGIGKILAERVVNTLGEKTID
LIVNQPERLKEVKGLTKNKQQMLHEKVKANRGNEDTFIQLSEMGFSNHLAGKIYAKYQDE
AVELIKENPYFLVKNIQGFGFQKADLLAQRLDFAYDSPLRIQGAITFSLETICYSNGDTY
VKKEELFHQVLNLLNKSQMNLQMVDMQQVADSLSDLVDTNEVIATEEGYFLPSLYYAEKG
IVKRLKRIKNERTQPKYENDNLANEIEETEAKLGIQYGPAQRKAIIEALEEKLFILTGGP
GTGKTTVLEGIIDIYCRLNNIRLGDYDPSDFPIRLAAPTGRAAKRMSETTGLVATTIHRL
IGLTGEEDENNIITSDKETIEGDLLIIDEMSMVDTWLFFQLLEAVPDDMQIILVGDKDQL
PSVGPGQVLSDLLRSQTITWRELDEIFRQDANSTITLLAHDIKNGQMPVDLTQNKADRSF
FRVDYFHLADFIAAVAKRALEKDYDVKDIQVLAPMYKGQAGIDQINQKLQESLNPNTDGS
KRQLSHFNRLFRLGDKVLQLQNHAEMNVFNGDMGEIVAIFFAKETTSQSDEIVVDFDGNE
VTYNRQDFNQLTLAYCVSIHKSQGSEFPIVILPLISQYQRMLQRNLLYTAITRAKQSLIL
CGEVQAFQSAIQTQASQRHTNLYRSLLEEDELLPKLNSQPSEVSPSQDQSTRSQGDESGG
QQGDLENSGMNVKVDWLTPALLESGQIDPLIGMDGISPYDF
NT seq 2466 nt NT seq  +upstreamnt  +downstreamnt
atggcagctacagaagattatttcatcggcgaggttgaagctacctttttttctaatcca
gataattattatcgggtgatgcggattacggttgatgataccaacaccctttactccgaa
aaaaatattgtcgtgactggaaattttgggactattcaagacggaaccacataccaattc
ttcggtaacttggttgaccatcctaagtacggggtacaatttaaagtctctcattatgaa
gggataaaaattaccagtaaagatggattaatcaaatatttatccagtgatgaattccct
ggaattggaaaaatactggctgaacgtgtggtcaataccttaggtgagaagaccattgac
ttaattgtaaatcaacccgaacgtttgaaagaagttaagggcctgacgaaaaataaacag
caaatgctacatgagaaagtaaaggctaatcgtggcaatgaggatacctttattcaatta
tcggagatgggtttttccaaccatttagcagggaagatctatgctaaataccaagatgaa
gcggttgaattgattaaagaaaacccctatttcttggttaaaaatattcagggttttggt
tttcaaaaggctgatttactggctcaacgtttagactttgcctatgactcgcctttacgc
atccaaggggcgattactttttcattagaaacaatttgttatagcaatggggatacttat
gttaagaaggaagaactattccaccaggttctcaatctattaaataaaagccaaatgaat
ctacaaatggttgacatgcagcaagtggctgatagcttgagcgacttggtagataccaat
gaagtgattgcgactgaagagggttattttcttcctagtctctattatgcagagaagggg
attgttaaacgtttaaaacgtatcaagaatgaaagaactcagcctaaatatgagaatgat
aatttggctaatgaaatagaggaaaccgaagcaaaattaggtattcaatatggacccgct
caaaggaaggcaattatcgaagccctagaagagaaattatttattcttaccgggggaccg
ggtacgggaaaaaccaccgttttagaagggatcattgatatttattgccggttaaataat
atccgcctaggggattatgatccaagtgactttcctattcgtttggcagcaccaactgga
cgcgctgccaagcggatgagtgaaactactggcctagtagcaaccactattcaccgttta
ataggtctcaccggtgaagaagatgaaaataatatcataacttctgataaagagactatt
gaaggggacttactgattattgatgaaatgtccatggtagatacctggttattctttcag
ttattagaagcggttcctgatgatatgcaaattatcttggtaggggataaagatcaactg
ccctcagttggtccaggacaagtgctttctgacctcttgagaagtcagacaatcacctgg
cgtgagctcgacgaaatatttcgtcaagatgctaattcaactatcactctattggctcat
gatataaaaaatgggcaaatgccagtcgatctgacccaaaataaggctgatcggtcattt
ttccgggtggattatttccacttagctgattttatcgcagcggtggctaaacgcgctctt
gaaaaagattatgatgttaaagatattcaagttttagctcccatgtataagggtcaggcc
ggcatcgatcagattaaccagaaattgcaggaaagcttaaatccaaatactgatggaagt
aagcgccaacttagccacttcaaccgtctttttcgcttaggtgataaggtcttacagttg
caaaatcatgctgaaatgaatgtttttaacggggatatgggagaaatcgtggcgatattc
tttgccaaggaaacgaccagccaaagcgatgaaatagtggttgatttcgacggcaatgag
gtcacatacaaccggcaagattttaaccagttaaccttggcgtattgcgtctcaattcat
aaatcgcagggaagcgaatttcctatcgttatcctccccttaatcagccaataccaacgc
atgttgcaacgcaatttgctctatacagcgatcaccagagctaagcaatccttaattctc
tgcggtgaagtccaagccttccaatctgccattcaaacccaggccagccaacgccatact
aacctttaccgctccctacttgaagaagacgaattacttcctaaactgaactcgcagcca
agtgaagtaagtcctagtcaggatcaaagtaccaggtctcaaggagatgagtcagggggc
caacaaggggatcttgaaaactcgggaatgaatgtaaaagtcgattggttaactcctgcc
ttacttgaaagtggtcagatcgatcctttaattggtatggatggcatcagcccctatgat
ttttaa

DBGET integrated database retrieval system