KEGG   Aerococcus urinae: HMPREF9243_1075Help
Entry
HMPREF9243_1075   CDS       T01447                                 

Definition
succinyl-diaminopimelate desuccinylase (EC:3.5.1.18)
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
aur  Aerococcus urinae
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:aur00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    HMPREF9243_1075
  Amino acid metabolism
   00300 Lysine biosynthesis
    HMPREF9243_1075
Enzymes [BR:aur01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     HMPREF9243_1075
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1101564..1102724
Genome map
AA seq 386 aa AA seqDB search
MLFTDEEKLQILRDVLAIESENDREAEVAEYFSRLLAKYGIESEIIEYQAGRSSLIANIH
GSEGGEGKVLVYSGHFDVVSAGDPSDWTYPPFAGEIHDGKIYGRGTSDMKSGLVDLVLAA
IELKEAGANFKGCLRLALTVGEEIGMYGSKQLVEAGYLDDADGFLIAEPSGSESVIYAHK
GSIQYEIIARGKTVHSSMPEVGIDALQLMVDYINLSNQRFDESFNTESAYNADLGKTLNV
NTVIEGGTQINSVAGLVKMKANTRTVPEADNDLVLSIINDCIEELNAKSEGYLELNLLQN
NPPATSTEDNDLIKAIQSSVSHELELTVTGGATDASNFGQIGEDYDLAVYGPGEPSVAHQ
ENEYVSLDKFLAFVDIYKETALNYLK
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgctgtttacggatgaggaaaaattacagattttacgcgatgtattagcaattgaaagt
gaaaatgatcgagaggcagaggtcgctgaatattttagccgcttactggctaagtatggt
attgagagcgaaattattgaataccaagctgggcgctcttcgcttattgccaatatccat
ggtagtgaaggtggagaaggaaaggtcttagtctattcagggcatttcgatgtcgtatct
gcaggcgaccctagtgattggacctatccaccttttgctggagagattcatgatggaaaa
atctatggcagggggacttcagatatgaagtctggtttggttgacttggttttggctgcc
attgaattaaaggaagccggcgccaattttaaaggttgtctacgcttagccctgacggtt
ggtgaagagattggcatgtatgggtccaaacaattagtcgaagcaggttatttagatgat
gccgatggctttttaattgcagaaccatcagggagtgagtcagtgatatatgcccataaa
ggatctatccaatatgaaattattgcccgtgggaaaactgttcactcttccatgccagaa
gtgggtattgatgccttgcagttaatggttgattatatcaacttaagtaatcaacgtttt
gatgaaagctttaatactgaatccgcttataatgctgacctagggaagaccctaaatgtc
aatacagtgatcgagggggggactcagatcaatagtgtggctggtttagtaaaaatgaaa
gccaatacccggacagttcctgaagcggacaatgatttagttttatcgataattaatgac
tgtatcgaagagttaaatgctaagagtgaggggtatttagaattaaatcttcttcaaaac
aatccaccagcaacctcaacagaagataatgatttaattaaagccatccaatccagtgtc
agtcatgaattagagctgaccgttaccggtggagcaacagatgcttctaatttcggtcaa
attggtgaagactatgatttagcggtttatgggccaggagaaccctcagtcgctcaccaa
gaaaatgaatatgtctccttagataaatttttagctttcgtcgatatctataaagaaaca
gccctaaactaccttaaataa

DBGET integrated database retrieval system