KEGG   Aerococcus urinae ACS-120-V-Col10a: HMPREF9243_1160Help
Entry
HMPREF9243_1160   CDS       T01447                                 

Definition
(GenBank) acetyl-CoA C-acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
aur  Aerococcus urinae ACS-120-V-Col10a
Pathway
aur00071  Fatty acid degradation
aur00072  Synthesis and degradation of ketone bodies
aur00280  Valine, leucine and isoleucine degradation
aur00310  Lysine degradation
aur00362  Benzoate degradation
aur00380  Tryptophan metabolism
aur00620  Pyruvate metabolism
aur00630  Glyoxylate and dicarboxylate metabolism
aur00640  Propanoate metabolism
aur00650  Butanoate metabolism
aur00900  Terpenoid backbone biosynthesis
aur01100  Metabolic pathways
aur01110  Biosynthesis of secondary metabolites
aur01120  Microbial metabolism in diverse environments
aur01130  Biosynthesis of antibiotics
aur01200  Carbon metabolism
aur01212  Fatty acid metabolism
aur02020  Two-component system
Brite
KEGG Orthology (KO) [BR:aur00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    HMPREF9243_1160
   00630 Glyoxylate and dicarboxylate metabolism
    HMPREF9243_1160
   00640 Propanoate metabolism
    HMPREF9243_1160
   00650 Butanoate metabolism
    HMPREF9243_1160
  Lipid metabolism
   00071 Fatty acid degradation
    HMPREF9243_1160
   00072 Synthesis and degradation of ketone bodies
    HMPREF9243_1160
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    HMPREF9243_1160
   00310 Lysine degradation
    HMPREF9243_1160
   00380 Tryptophan metabolism
    HMPREF9243_1160
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    HMPREF9243_1160
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    HMPREF9243_1160
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    HMPREF9243_1160
Enzymes [BR:aur01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     HMPREF9243_1160
Exosome [BR:aur04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   HMPREF9243_1160
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C
Motif
Other DBs
NCBI-ProteinID: AEA01661
UniProt: F2I522
Position
complement(1194770..1196017)
Genome map
AA seq 415 aa AA seqDB search
MLKAKNEEVVFVGAARTPVGAYLGDLKTVPVDELGVISLTEAAKRAGVAVEDIEEVIVGH
VTGSQTTNNLGNIIGIDAGVKNTATGMTINRICGSGIQSAVSAAQELLFSNKSIIAAGGV
ESLSRAPFYLPESARYEGLKGGNKPLIDANLAGHSSASGKDSGVNHMGNTAENVARKYGI
TRERADQFAVESQRKAAEAIENGRFAQEIIPVEVKGRKGKVNVVEKDGHPRPGTSMESLA
KLRPAFEKDGIVTAGNASGLNDGGAFEIMTTKSVAEERGLEIMARVVDYQIAGCDPAYMG
LGPVQAIKDILARQEMDLKEDIDVLEINEAFAAQTIGCLIELGIEEDTDFYKNHFNPHGG
AVALGHPLGMSGARIITSLLYEFKNHPEYRYAIASACIGGGQGIALLLENGYYQG
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
atgttaaaagctaaaaatgaagaagttgtttttgttggtgccgcacggactcctgttggt
gcttacctaggcgacttaaagactgtaccagttgatgaattaggggtaatttctcttaca
gaagctgctaaacgtgctggtgttgccgttgaagatattgaagaagttattgttggtcat
gtcactggatcacaaacgaccaataatttaggtaacattatcgggattgatgcaggagta
aaaaatactgcaacaggtatgactattaaccgtatctgtggatcaggtattcaatccgct
gtatcagccgcacaagaattactattctccaacaaaagtattattgctgctggtggggta
gaatctttatcacgtgcgcctttctatctaccagaatccgctcgttatgagggattaaag
ggaggcaataaacctttaattgatgctaacttagctggccatagctctgcttctggtaaa
gattctggtgttaaccacatggggaacactgcagaaaatgttgctcgtaaatacggaatt
actcgtgaacgcgctgaccaatttgcagtagaatcccaacgtaaagctgcagaagctatt
gaaaacggacgttttgctcaagaaattattccggtagaagttaaaggacgtaaggggaaa
gttaacgtcgtagaaaaagacggtcatccacgtccaggaacatcgatggaatcattagct
aaattacgcccagcttttgaaaaagatggtattgttactgcaggtaatgcttctggatta
aatgacggtggtgcttttgaaattatgaccactaaatcagttgctgaagaacgtggctta
gaaatcatggctcgcgttgtggattatcaaatcgcaggttgtgatccagcctacatgggc
ttaggaccagttcaagctattaaagatattcttgctcgtcaagaaatggatcttaaagaa
gatattgatgtactagaaattaatgaagcctttgcggctcaaaccattggttgcttaatt
gaacttggtattgaagaagatactgacttctacaagaatcatttcaacccacatggtggt
gcagttgctttagggcacccattaggcatgtctggtgcacgtatcattacatctctattg
tatgaattcaagaaccatccagaataccgttacgcgattgcttcagcatgtatcggtggt
ggacaaggtattgctctcttacttgaaaatgggtattaccaaggctaa

DBGET integrated database retrieval system