KEGG   Aerococcus urinae: HMPREF9243_1269Help
Entry
HMPREF9243_1269   CDS       T01447                                 

Definition
Mur ligase middle domain-containing protein
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
aur  Aerococcus urinae
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:aur00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:aur00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1297815..1299170)
Genome map
AA seq 451 aa AA seqDB search
MTLRSQVAKHSARLVQILLKKLTKGGSSLPGKIAKKLDPAILAELGKNYRVVIITGTNGK
SVTTALTVNILRQKFDEVLTNDTGSNLEQGIISTFLNANSKGQGDKIAVLEVDEASVRHI
TEYIKPEVILVTNLFRDQLDRFGEIYTTFDYILEGANKSPKSLLLMNGDAPIFASRDFHH
NVAYFGFSNSDKTTDKMAHYNTDGVLCPRCEHILHYHMITYSNLGDYFCPNCQFHRPSLT
YSVDQVDKLTPETSTFTIEGQSFTIPVAGIYNIYNALAAYSIARYLGLSQTAIHEGLQGA
KRMFGRQEALTIHGKDTRINLIKNPVGFNQIVSLLELDQEEFSLLVLLNDNPADGQDISW
IWDAMFENIAQLPNIKATAVGGIRVKDLKVRMQVAGFDEDRLEELSNSQGALQWIASVPS
QKVYVLATYTAMLDFRRELADQHLVKERMKS
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
atgacattgcgttcacaagttgccaagcatagcgcccgcttggtgcaaattttactcaag
aaattaaccaaaggcggatcaagtttgccagggaaaattgctaaaaaattggatccggct
attttagctgaactgggcaaaaattaccgggtagttatcattaccggaaccaatggtaaa
tcagttaccacggctcttaccgttaatattttgcggcaaaagtttgatgaagtattaacc
aatgataccggctcaaacctagaacaagggattatatccactttcttgaatgctaattcc
aaaggacagggggataaaatagctgttcttgaggttgatgaggctagcgttcgccacatt
accgaatacattaaaccggaagtgatcttagtaactaatctatttagagatcagttggac
cgctttggggagatttatacgaccttcgattacattttagagggggctaataagagtccc
aaaagcttgctcttgatgaatggtgacgcgccaatttttgcgtcacgggactttcatcat
aatgtggcttactttggttttagtaattcggataaaacgactgataagatggcccattat
aataccgacggggtcctatgtccccgctgcgagcatatccttcactatcatatgattact
tatagtaatttaggggattatttctgccctaattgtcagtttcaccggccaagcttaact
tattcagtggaccaggtggataagttaactccagaaacttcgacatttactattgagggt
caatcctttaccatcccagtcgcgggcatttataatatatataatgccctagcggcttat
tcaattgctcgttatttagggctaagtcaaacagccattcatgagggcttgcagggggcc
aagcggatgtttggtcgccaagaggccttaaccattcatggcaaggacacccgtattaat
ctcattaagaacccggttggttttaaccaaatcgtttctttattggagttagaccaagaa
gagttttctctactagttctcctcaatgataatcctgctgatggtcaggatatttcctgg
atttgggacgccatgtttgaaaatatcgcccaattacctaacattaaagctacggcggta
gggggcatacgggtaaaagaccttaaagttcggatgcaagtggccggttttgatgaggac
cgcttagaagaactttctaattcacagggagcccttcaatggattgcatctgtccccagc
caaaaagtctatgtcttagccacctatactgccatgctcgattttagacgagaattagct
gaccaacatcttgtgaaggagcggatgaaatcatga

DBGET integrated database retrieval system