KEGG   Aerococcus urinae: HMPREF9243_1286Help
Entry
HMPREF9243_1286   CDS       T01447                                 

Definition
hypothetical protein
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
aur  Aerococcus urinae
Brite
Enzymes [BR:aur01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     HMPREF9243_1286
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1315867..1316616)
Genome map
AA seq 249 aa AA seqDB search
MQKQESFYFTGDNEVAVLLFHAYTGTTADVRMTGRALNREGYTVYCHNLTGHGTGRVEDI
LAADPSDWIEDARQALAFIKSQGYDKLAVFGLSLGGSIATKLFIEEESQFIAAGSFCTPI
MTTNIEETNVGKAFMAMARNVKEKEGFSGEVLEAELKDIEADLSLSLEKINRFNNSMHSQ
LGTITKPYFIAEAGQDELVGDNSGRLLKEAMPNAQVTLAHFEDSGHVITVGKAHQAFEQA
LIEFLNQVV
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaagcaagaatcattttattttaccggcgataatgaagtagctgtcctcttattt
catgcttatacaggaaccacagctgatgtaagaatgacagggcgggctttgaatcgtgaa
ggctatactgtctattgtcataatttaaccggtcatggcactggacgcgtagaagatatt
ttagcagcagatccaagtgattggatcgaggatgctcgccaagctttagcctttatcaaa
agccaaggctatgacaagctagcggtctttggtttgtctttgggtggttctattgccacc
aagttatttattgaagaagagagtcaatttatagcagctggctctttctgtacgcctatt
atgactacaaacattgaagaaacgaatgtaggaaaggcttttatggccatggctagaaat
gtcaaagaaaaggaaggctttagtggagaggttctggaagcggaattaaaggacattgaa
gcggacctatctctttccctagagaagatcaatcgttttaacaattctatgcatagccaa
ctagggacaatcactaagccttatttcatcgctgaagccggtcaagatgaacttgtcggt
gataatagtggtcgtctgttgaaagaagctatgcctaatgctcaggtgaccttagcccat
tttgaagatagtggccatgtgattaccgttggcaaagcccatcaagcatttgaacaagca
ctaatcgaatttctcaaccaggtggtgtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system