KEGG   Aerococcus urinae: HMPREF9243_1295Help
Entry
HMPREF9243_1295   CDS       T01447                                 

Gene name
tpiA_2
Definition
triose-phosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
aur  Aerococcus urinae
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:aur00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    HMPREF9243_1295 (tpiA_2)
   01230 Biosynthesis of amino acids
    HMPREF9243_1295 (tpiA_2)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HMPREF9243_1295 (tpiA_2)
   00051 Fructose and mannose metabolism
    HMPREF9243_1295 (tpiA_2)
   00562 Inositol phosphate metabolism
    HMPREF9243_1295 (tpiA_2)
Enzymes [BR:aur01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     HMPREF9243_1295 (tpiA_2)
Exosome [BR:aur04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   HMPREF9243_1295 (tpiA_2)
  Exosomal proteins of bladder cancer cells
   HMPREF9243_1295 (tpiA_2)
  Exosomal proteins of melanoma cells
   HMPREF9243_1295 (tpiA_2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1322947..1323702)
Genome map
AA seq 251 aa AA seqDB search
MRQVLIAGNWKLNKTASEATDFIEDLKAKLSGKEKAEVLVCPPALYVQSLLSESQDTNIK
VGAQNCYYENSGAFTGEISPLALADLGASYVVIGHSERRELFNESDEDVAKKAKAIFDNG
MTPIICCGETLEQREEGIAKEWITGQIKAALKELSQEEIAKSVIAYEPIWAIGTGKTASP
EDAEEICSHIRDVVFEVAGQEASDAVRVLYGGSVKPANVKDILAQENIDGALVGGASLQV
DDFLALVNAAE
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
gtgagacaagttttaattgccggaaactggaaattaaataaaaccgctagtgaagcaaca
gattttattgaagacttgaaagctaaattaagtggtaaggaaaaggctgaagttttggtt
tgcccaccagctctatacgttcaaagcttactctctgaaagtcaagacactaacattaaa
gttggtgctcaaaactgctactatgaaaatagtggggctttcactggagaaatttcacct
ttagctttagcagatctaggagcgagctacgtggttatcggccactctgaacgtcgggaa
ttatttaacgaaagcgatgaagatgttgctaagaaagctaaagcaatcttcgataatggt
atgacaccaattatttgttgtggtgaaaccttagagcaacgtgaagaaggtattgccaaa
gaatggatcactggacaaatcaaggcagccttaaaagaacttagccaagaagaaattgct
aaaagtgtcattgcttatgaacctatctgggcaattggtaccggtaaaaccgcctctcca
gaagacgctgaagaaatttgtagccacattcgtgacgttgtctttgaagtagctggtcaa
gaagctagtgacgctgttcgtgtcctctacggtggttcagtgaaacctgctaatgttaaa
gatatcttagcccaagaaaatattgatggtgccctagtagggggagctagtcttcaagtt
gacgattttcttgctttagttaatgctgcagaataa

DBGET integrated database retrieval system