KEGG   Aerococcus urinae: HMPREF9243_1606Help
Entry
HMPREF9243_1606   CDS       T01447                                 

Gene name
thrC
Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
aur  Aerococcus urinae
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:aur00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    HMPREF9243_1606 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HMPREF9243_1606 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    HMPREF9243_1606 (thrC)
Enzymes [BR:aur01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     HMPREF9243_1606 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1615558..1617033)
Genome map
AA seq 491 aa AA seqDB search
MLYTSTRNSQLSVRSTEAILQGLAPDGGLYVPKSIPHYEGDWETMSKLSYQELAFQILSL
YFDDFPKDILQSCIQAAYDEKFDDDRIAPVVGLSDHYLLELFHGPTIAFKDMALSLLPHL
MKAAQKVLGRDEEIIILTATSGDTGKAAMAGFEDVTGTKIIVFYPKGGVSSIQEKQMLTQ
KGDNTYVFGVKGNFDDAQSKVKELFNDKDLAAELQANHSQFSSANSMNIGRLFPQVVYYF
YAYGQLLKQGAIQAGDLVNFTVPTGNFGNILAGYYAKQMGLPIDRLVCASNDNTVLYDFF
TSGTYDRRRPFKLTISPSMDILVSSNLERLLYYAVDQDSQAVKDLMAALQDEGHYQLGQE
VKAAFDSFIGAYSDEAETRAEIKRVYQEDHYLMDPHTAVASACLGKVKDQLAGESIVVST
ASPFKFPAAVLESIDEGDSHLSDLELLEAVQAANGLDYPQAIQAILEADSRPERVIEVEE
METVVREIAKG
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atgttatacacaagtacgagaaatagtcagctttctgttcggtcaacagaggcgattttg
caaggtctagcgcctgatggggggctgtatgttcctaaatcgattcctcattacgaagga
gattgggagacgatgagcaagttgtcctaccaggaactagcctttcaaattttaagcctc
tattttgatgatttccctaaggacattttacaatcctgtatccaagccgcctatgatgaa
aaatttgatgatgaccggattgcaccggtcgtaggcttatcagaccactatcttttggag
cttttccatggtccaacgattgcctttaaggatatggccttatccctactgcctcattta
atgaaggctgcccaaaaagtcttgggtcgcgatgaagaaattatcattttaaccgcgact
tcaggagacaccggtaaggccgctatggctggctttgaagacgtgactgggactaagatc
attgtcttctatcccaagggcggggtttccagcattcaggaaaaacaaatgctgactcaa
aaaggagacaacacctatgtctttggggtcaaagggaactttgatgacgctcaaagtaaa
gtcaaggagcttttcaatgataaggacttagcagcggaacttcaagccaaccatagccaa
ttttcttctgctaattccatgaatatcggtcgcttgttccctcaagtggtttactatttc
tatgcctatgggcaattactgaaacagggcgctattcaagcaggggacttggtcaacttt
acggtgccaaccgggaattttggaaatatattggctggctactatgctaagcaaatgggc
ctaccgattgaccgcctagtctgtgcctctaacgataataccgtcctttatgacttcttc
actagcggaacttatgatcgccgtcgcccctttaagttgactatatctccatcgatggat
attttggtctccagtaatctggaacggctcttgtattacgccgtggaccaggatagtcaa
gcggtcaaagacttgatggctgcattacaggatgaaggtcactaccaattaggtcaagaa
gtgaaagcggcctttgatagctttattggagcctatagtgatgaagctgaaactagagca
gaaattaagcgcgtttaccaagaggaccattacctcatggacccccatacggccgtggct
tccgcctgcctaggcaaggtgaaggaccagttagcgggtgaaagtattgtggtgtcgaca
gctagtccttttaaattccccgctgccgttttagaatcgatcgatgagggcgacagtcat
ttaagtgatttagagctcttagaagcagtgcaagcggccaatggcttggactatccccaa
gcaatccaagccatccttgaagcggatagccggcctgaacgggtgattgaagtggaggaa
atggaaacagtggtaagagagattgccaaaggatag

DBGET integrated database retrieval system