KEGG   Aerococcus urinae ACS-120-V-Col10a: HMPREF9243_1679Help
Entry
HMPREF9243_1679   CDS       T01447                                 

Gene name
ispE
Definition
(GenBank) 4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
aur  Aerococcus urinae ACS-120-V-Col10a
Pathway
aur00900  Terpenoid backbone biosynthesis
aur01100  Metabolic pathways
aur01110  Biosynthesis of secondary metabolites
aur01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:aur00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    HMPREF9243_1679 (ispE)
Enzymes [BR:aur01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     HMPREF9243_1679 (ispE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_C GHMP_kinases_N
Motif
Other DBs
NCBI-ProteinID: AEA00571
UniProt: F2I726
Position
complement(1690273..1691145)
Genome map
AA seq 290 aa AA seqDB search
MAIREKALAKINLAQDIYYQAEDDCFYFDMVMASVDLADYLAIEENDSGEVFIRSNQHFL
PRDQRNHAYQAAVKMKDLAGVDRGVTISIRKYIPVSAGLGGGSSDAAAVIRGLNRLWHLD
WSLDQLMDIAVTIDSDAPYCLRGGLCRMTGSGSNYEPLPSLPSSWLVLAKPAFSISTPKM
LAALKDHPQKLSTHAGPVTEAIKNGDYQQVMAEVGNSLEAITFSYYPKLKALKERMQNFG
AQGVTMTGSGSTIIGFTRQQQQAKRIYNGLKGFCEEVYVVRMNQNLRNIS
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atggctattcgagaaaaagctttagctaagattaatctcgcccaggatatctactatcaa
gcagaggatgactgcttttactttgatatggtcatggcttcagttgacctggctgattac
ctggccattgaggaaaacgatagtggtgaggtttttatccggtctaaccaacattttttg
ccccgggaccaacgtaaccacgcctaccaggccgctgtaaaaatgaaggatcttgccgga
gtagatcggggtgtaaccatttctatccgtaagtatattccggtttcagccggacttggg
ggtggatcgagtgacgcagcggcggtcatccgcgggctaaatcgtctctggcatttggat
tggtcccttgaccaactcatggatattgccgtaaccattgatagtgatgctccctattgt
ttaagaggaggattgtgtcggatgaccggctcgggaagcaattatgaacccttaccgtcc
ttaccttcaagctggttggtcctagctaaacctgctttttccatttccaccccaaagatg
ttagctgccttaaaagatcatccccaaaagctttctacccatgcgggtccagtaacggag
gccattaagaacggagattatcaacaagtgatggcagaagttggcaattccctagaggcc
attacttttagttattatcccaagttaaaggccttaaaggaacggatgcaaaatttcggc
gctcaaggggtaaccatgacggggagtgggtcgaccattattggctttacccgccagcaa
caacaagctaaacggatttataatggcctaaaaggcttttgcgaagaggtttatgtggta
agaatgaatcaaaatctcagaaatattagttaa

DBGET integrated database retrieval system