KEGG   Aerococcus urinae: HMPREF9243_1732Help
Entry
HMPREF9243_1732   CDS       T01447                                 

Gene name
cobA
Definition
uroporphyrinogen-III C-methyltransferase (EC:2.1.1.107)
Orthology
K02303  
uroporphyrin-III C-methyltransferase [EC:2.1.1.107]
Organism
aur  Aerococcus urinae
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:aur00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1744112..1745122)
Genome map
AA seq 336 aa AA seqDB search
MTSGKVYLVGAGLGRLGNLSLAAYDCLQKADIIFYDRLINQNLLQVAPSSCLLVNVGKKP
GKHSHSQEEITQQLIQASQEYQVIVRLKSGDPYLFGRGGEEAMALSEAGVDFAVIPGITS
AIAGLAYAGIPATYRDKSSSLHIYTGQSRSGRTDLDYQAIVNSGGTAVFLMAVKALGAIV
SGLIGAGLNEKTPMAAIEWAGRAQERYLVSDLGHMIDDCQAARVKAPALFVLGEVVTDQQ
KLDFFSQAPLFGHQIAISAQTPLTDCLALEDLGADLIFYPDPAAESSRLELAKNALKQAD
IMISQDLLDPWQEKLAAETLHFHGSVDDFIHHFSKQ
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgactagcggtaaagtttatttagtaggtgccggcttaggccggctaggcaatctcagc
ttagcggcctatgattgcctgcaaaaggctgatattatcttttatgaccgtctcattaat
caaaatctactgcaagtcgccccaagttcctgcctcttggtgaatgttggcaaaaagcct
ggtaagcactctcattctcaggaagagattacccagcaacttatccaagccagccaggaa
tatcaagtcatagtccgattgaagagtggtgatccctacctctttggccggggtggggaa
gaagccatggccctgtcagaagcgggcgtggatttcgcagtcattcccgggattacttca
gccatcgccggcttagcctatgccggtattccagctacttaccgggataagtcaagttcc
ctacacatttataccggtcagagccgatcgggtcgaaccgacttagattatcaggccatt
gtcaatagcgggggaacggcagtctttctaatggcggtaaaggctctaggagccattgtt
agtggccttataggagctggcctgaatgaaaaaacgcctatggcagccatcgagtgggca
ggaagggcccaagaacgctacttggtctctgacctgggccatatgattgatgactgtcaa
gcggctcgggtcaaagcgcccgccctctttgtcctcggcgaggtagtgactgaccagcaa
aagcttgacttctttagtcaagccccgctctttggccaccagattgcgatttcggcacag
acgcctctaactgattgcctggctttagaggatttaggagccgatttaatcttttatcct
gatccagctgctgaaagtagtcgcctagagctagcaaaaaatgctctcaagcaggctgat
attatgattagccaagacctacttgatccttggcaagagaagctggcggcggaaacccta
catttccacggcagtgttgatgattttatccatcattttagtaagcaataa

DBGET integrated database retrieval system