KEGG   Aerococcus urinae: HMPREF9243_1747Help
Entry
HMPREF9243_1747   CDS       T01447                                 

Definition
putative threonine-phosphate decarboxylase
Orthology
K04720  
threonine-phosphate decarboxylase [EC:4.1.1.81]
Organism
aur  Aerococcus urinae
Pathway
Porphyrin and chlorophyll metabolism
Brite
KEGG Orthology (KO) [BR:aur00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    HMPREF9243_1747
Enzymes [BR:aur01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.81  threonine-phosphate decarboxylase
     HMPREF9243_1747
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1756991..1758076)
Genome map
AA seq 361 aa AA seqDB search
MPKHGGNLKELSQEMGMDMTQALDFSANINPLGLPQAFKEVIVSHLDQLDRYPDYSYRDL
RQTLADYYQMSYDHLLVGNGAAELIDLLAFALPYPMVTIEPCFNEYSASAKKYQRPHWSH
LTQAENDFTFSLETFWSWLDDHRDRELDQGMAFSVWLCQPNNPTGTLYNPNLLSELLSGV
SDRGGFLLVDESFIDFLPDQADYSLLGRVEKEENLVIIRSLTKFYAMPGLRLGVAMTSNQ
SLLHDLEGAQLTWSVNALAEACGRKMSDLSAYRQDSLNYLAAAKKDLQAGLENYTSLKIF
PSAANFFLIQGPKDLAQNLLEKGIVLRQTADFKGLGPGYYRLAVRTKEENQALLQALADI
L
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgccaaaacatggtggaaatttaaaggaacttagtcaggaaatgggcatggatatgact
caggccttggacttttccgcaaatattaaccccctcggcttaccccaagcctttaaggaa
gtcattgtttcccatttggaccagctggaccgttatccggattacagctatcgggattta
cgccaaaccttggcggactactatcaaatgtcctatgaccacttactggtgggcaatggg
gccgcagaattgattgaccttttggcctttgccttgccgtatcccatggtgaccattgaa
ccttgctttaatgagtactcagctagtgctaagaagtaccagcgcccccattggtcccat
ctgactcaggcagaaaatgattttacctttagcttagaaactttctggtcctggctcgat
gaccatcgggaccgagagctagaccagggcatggccttctcagtctggctctgccagcct
aataatcccactgggaccttgtataaccccaacttattaagtgagttattaagtggcgtc
agcgaccgcggaggatttttattggtggatgaatcctttattgattttcttcctgaccag
gctgactattccctgctgggacgagtagaaaaggaagaaaatttggtgattatccgctct
ttgaccaagttttacgctatgcctggcctgcgtttaggcgtggccatgaccagtaaccag
tccctcttgcatgacttagagggggcccaactgacctggtcagtcaatgccttagcggaa
gcctgtggtcggaaaatgtctgacttatccgcttaccgtcaagactctttgaattattta
gctgcagctaaaaaagacttgcaggcaggattggagaattataccagtttgaaaatcttt
cctagcgcagctaacttctttttaatccaggggcctaaagacttggcccaaaacttactg
gaaaagggcattgttttgcgacagacagctgacttcaagggtttgggacctggctactac
cgcctggctgttcgaactaaggaagaaaaccaggctttgcttcaagccttggcagatatt
ttatga

DBGET integrated database retrieval system