KEGG   Aerococcus urinae: HMPREF9243_1887Help
Entry
HMPREF9243_1887   CDS       T01447                                 

Gene name
trpC
Definition
indole-3-glycerol phosphate synthase (EC:4.1.1.48)
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
aur  Aerococcus urinae
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:aur01230]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:aur00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1902091..1902891
Genome map
AA seq 266 aa AA seqDB search
MILKQLALHSKERVLASQAKFPLEAVKERALSLAKGELIFEQALAKEGLSLIAEIKKASP
SKGVISPDFPYLDIAKHYQDNQVDAISVLTEPKWFMGSKEIFQEVRQTVDLPLLRKDFTV
DPYQLYEAKIMGANAVLIICSLLDQGPSQLENYLSICHDLGLSALVETHNLEEIDLALAC
GAKIIGVNNRNLKDFSVNFNHAAELRSRIPDSVLFVAESGVYGSEDIQSLNEIGADAVLV
GEALMRQDDPSALIQAFRKVSQAYEA
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atgatcttgaagcagttagccttacatagtaaggaacgggtcctagccagtcaggctaag
tttcccctagaagccgttaaagagcgcgcactcagtcttgctaagggagagcttatcttt
gaacaggccttggccaaggaaggactgagcctgattgctgaaatcaagaaggcttccccc
tctaaaggagtgatttctccagactttccctacttagatattgccaagcactatcaagac
aatcaagtagacgccatctcggtattaactgaacccaaatggtttatgggctctaaggaa
atctttcaagaagtccggcaaacagtggaccttcccctactcagaaaggactttaccgtc
gacccttatcagctctatgaagctaaaatcatgggcgccaatgcggtcttaatcatctgt
tcactcttagatcaagggcctagccagttagaaaattatttaagtatttgtcatgaccta
ggcctcagtgccctggtggaaacccataacctggaagaaatcgacctggccttagcctgt
ggcgctaagattatcggggtcaataaccgcaacttgaaggacttctctgttaacttcaac
catgcagccgagctaaggagtcggattccagattcggttctctttgtcgcagaaagcggg
gtatatggttcagaagatattcagtccctgaatgaaattggcgcggatgccgtcttagtg
ggcgaagctttgatgcgtcaagacgatcctagcgcccttatccaagcctttcgaaaggtt
agccaagcctatgaagcttaa

DBGET integrated database retrieval system