KEGG   Aerococcus urinae ACS-120-V-Col10a: HMPREF9243_1889Help
Entry
HMPREF9243_1889   CDS       T01447                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
aur  Aerococcus urinae ACS-120-V-Col10a
Pathway
aur00260  Glycine, serine and threonine metabolism
aur00400  Phenylalanine, tyrosine and tryptophan biosynthesis
aur01100  Metabolic pathways
aur01110  Biosynthesis of secondary metabolites
aur01130  Biosynthesis of antibiotics
aur01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:aur00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HMPREF9243_1889 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    HMPREF9243_1889 (trpB)
Enzymes [BR:aur01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     HMPREF9243_1889 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP HAD
Motif
Other DBs
NCBI-ProteinID: AEA00290
UniProt: F2I809
Position
1903476..1904660
Genome map
AA seq 394 aa AA seqDB search
MSKGRFGEYGGQFVAETLMPSVIELEAAYHKYKNDPEFQEELTDLLNNYAGRPSLLYYAK
NMTADLGGPKIYLKREDLNHTGAHKINNVLGQVLLAKKMGKTRIIAETGAGQHGVATATA
CALLNLDCVVYMGKHDTERQALNVYRMKLLGAQVVAVDSGTGTLKDAVNETMKEWSRRME
DTHYCIGSAMGPHPFPTMVRDFQSVISREMRQEILEREGRLPDAVLACVGGGSNAIGSFA
AFIDDPEVQLFGCEGAGHGVDSPDTAATMQVGRPGVYHGMKTIIAQDADGQVNPVYSISA
GLDYPGIGPEHANLAARKRAQYVPITDEEAVQAFEYLSRAEGIIPAIESAHAVAYAIKLA
KTMRPDQIICITLSGRGDKDCAAIARYRGEKIYD
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaaggaagatttggagaatacggtggccaattcgtggcagaaaccttaatgcct
tctgtcatcgaattagaagcagcctatcataaatataaaaatgaccctgaattccaagaa
gaattgacggatttattaaataattacgccggacgccccagcctactctattacgctaag
aatatgaccgcagatttaggcggtccaaaaatctacctcaaacgtgaagacctcaaccat
actggagcccataaaattaataatgttctcggtcaagtgctcttggctaaaaagatgggc
aaaacccggatcattgcggaaaccggagccggccaacacggggttgctactgcaactgcc
tgcgccttgttgaacttagactgtgtggtttacatgggcaaacacgataccgaacgccaa
gccctcaatgtctatcggatgaaattactgggcgcccaagtcgttgctgttgattccggc
actggcactttaaaagatgcggttaatgaaaccatgaaagaatggagccggcggatggaa
gacacccactattgcatcggttcggccatgggaccccacccctttccaaccatggtacgt
gacttccaaagtgtcatttcaagagaaatgcgccaagaaatccttgagcgcgaagggcgc
ttgccggatgccgttcttgcctgtgttggtggcggatccaacgctatcggctcttttgcc
gcctttatcgatgaccctgaagtacaattattcggttgcgaaggtgccggtcacggagtg
gatagtccagataccgccgccaccatgcaagtggggcggccaggggtctaccatggcatg
aagaccatcatcgcccaagatgcggatggccaggtcaaccctgtctattccatctcagca
ggtcttgactatccaggaattggccctgagcatgccaatctagctgccagaaagcgggcc
caatatgttcccatcacggatgaagaagcggtccaagcttttgaataccttagccgggcg
gaagggattattcccgccatcgaatctgctcacgccgttgcctacgccatcaaattagct
aaaaccatgcgccccgaccaaattatctgtattaccttgtctggtcgtggtgataaggat
tgtgccgccattgcacgttaccggggggaaaaaatttatgactag

DBGET integrated database retrieval system