KEGG   Aerococcus urinae: HMPREF9243_1890Help
Entry
HMPREF9243_1890   CDS       T01447                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase, alpha subunit (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
aur  Aerococcus urinae
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:aur00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    HMPREF9243_1890 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HMPREF9243_1890 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    HMPREF9243_1890 (trpA)
Enzymes [BR:aur01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     HMPREF9243_1890 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1904653..1905426
Genome map
AA seq 257 aa AA seqDB search
MTSIQSVFQNKKAFIPYITAGYPDLASTERYIEAMAEEGASLIEIGIPFSDPTAEGPVIQ
HAIETALAAGLHTDDVFAMVERLQKKIDTPLVFMTYANIVFGYGPKKFMRRCQEVGIQGI
IIPDVPYEEKGELLPYSQKHGVALISLVAPTSHDRIHKIAKEAEGFLYVVSSLGVTGTRQ
NIQTDLGAMIEAIRQANPDIPAAIGFGVSNPSQAKQMADLSDGVIIGSAIIKLIDQYQDQ
AEEPIRAFTRSIVQAIQ
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgactagcattcaatccgttttccaaaataaaaaagcttttattccttatataaccgcc
ggctatcctgacctcgccagcaccgaaagatatattgaagccatggccgaagagggagcc
agtttaattgaaattggtattcccttctccgatcctacggcagagggtccagtcatccaa
cacgctattgaaacagccttagcagctggtctccatactgatgatgtcttcgctatggtt
gagcgcctccaaaagaaaattgacacccccttggtctttatgacctatgccaatatcgtc
tttggttatggcccaaagaaattcatgcgccgctgccaagaagtgggtattcagggaatt
atcatccctgacgtgccttacgaagagaaaggcgagctcctcccctatagtcagaaacat
ggagtcgccttaatctccttagtcgcgccgacttcccatgaccgcatccataaaatcgct
aaagaagcggaaggtttcctttatgttgtttcatcactaggagtaaccggaactcggcaa
aacattcaaacagaccttggcgctatgattgaagccatccgtcaagctaaccccgatatt
cctgccgccattggctttggggtctctaatcccagccaagctaaacaaatggctgacctg
tccgatggggtgattattgggtctgctatcattaaactgattgaccaataccaagaccag
gcggaggagccgatccgtgcatttactcgatccattgtgcaagccattcaataa

DBGET integrated database retrieval system