KEGG   Anabaena variabilis: Ava_0127Help
Entry
Ava_0127          CDS       T00277                                 

Definition
arginase/agmatinase/formiminoglutamase (EC:3.5.3.11)
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
ava  Anabaena variabilis
Pathway
Arginine and proline metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:ava00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
170245..171285
Genome map
AA seq 346 aa AA seqDB search
MINQLQDYNPSGVGEINGNLLGLPCDYDSANLIVFAVPWEVTVSYGAGTANGPQRILDAS
VQLDLFDFDHPDGWKQGIFLVEIPQEIIEKNNYYRDLAAQIIERLAQGKLLTDTPDLTPV
LTEINQASQQVNQWLFTQCQVAMNQGKQVAVIGGDHSSPLGYFQALSAKYPNFGILHIDA
HADLRDAYEGFEFSHASIMFNGLKLPQISKLVQVGLRDISHDEVQMIDESHGRIVAYYDP
MIKQKLYGGTNWIELSREIVNHLPEYVHISFDVDGLDPKLCPNTGTPVPGGLELEQVFCL
FRELVNSGRKIIGFDVCEVGDGEWDGNVGARVVYKLANLMDLSHKQ
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgattaatcaactccaagactataaccctagcggcgtaggcgaaatcaatggcaatctc
ttaggtttgccctgcgattacgattctgcaaatttaattgtttttgcagtcccttgggaa
gttacggtttcctatggcgcaggtacagccaatgggccacaaagaattctggatgcttca
gtgcaactagatttatttgactttgatcatcctgatggctggaaacaaggaattttctta
gtggaaattccccaagaaattatcgagaaaaataattattatcgagatttagcagcacaa
attattgaacggctagcccaaggtaaattactcacagacacaccagatttaacacctgta
ctgacagaaattaatcaagcttcccaacaggtaaatcaatggctatttacacaatgtcaa
gtagccatgaatcaaggtaaacaagtagcagtcatcggtggtgatcacagttcaccttta
ggttactttcaagcattatcagcgaaataccccaattttggcattcttcacattgatgca
cacgcagatttacgtgacgcttatgaagggtttgagttttcccatgcgtcgattatgttt
aatgggttgaaactaccgcaaatttctaaactagtgcaagtaggtttacgcgatatcagt
catgatgaagtgcaaatgattgatgaatcccacggacgcatcgtggcgtattacgacccc
atgattaaacaaaaactctatggtgggacaaactggatcgaattaagccgcgaaattgtc
aatcacttgccggaatacgtccacattagctttgatgtggatggtttagatccaaaactt
tgtccgaatacgggtacacctgttcctggtggtttggaattggagcaagttttttgtcta
tttcgggaattggtaaatagtgggagaaaaattattggcttcgatgtctgcgaagttggt
gatggtgaatgggatggtaatgtaggggcgagagtggtttataaattagcaaatttaatg
gatttatctcacaaacaataa

DBGET integrated database retrieval system