KEGG   Anabaena variabilis: Ava_0198Help
Entry
Ava_0198          CDS       T00277                                 

Definition
multi-sensor hybrid histidine kinase (EC:2.7.3.-)
Orthology
K00936  
[EC:2.7.3.-]
Organism
ava  Anabaena variabilis
Brite
Enzymes [BR:ava01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.3  Phosphotransferases with a nitrogenous group as acceptor
    2.7.3.-  
     Ava_0198
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(252537..256571)
Genome map
AA seq 1344 aa AA seqDB search
MPSLYPVDLPTIEQVMECYPLTVLPDTLLVDVIALMNPVSRCTIVSASNFSSCVLVVEEK
KLVGIFTLRDVVRLTGVGVDISRKKISEVMTQPVISLTLAAAQNALTALAFMRQHHIRHL
PVVDEQGQLLGLITQDRIRQVVQPAHLLKLRCVTEVMVTEIIHALPTTSVLELSQMMSDR
RISCVVIVAPQETKLIPVGMITEKDILKVQLQGLDIAQTPAQTVMSSPVFSISPRESLWT
VNLLMQARGVRRLVVVGEQGQMQGLVTQTNLLQVLDPLEIVNVIQALEAKVAEQTFQLQQ
TNQQLEAEIKQRHQVEESMRQTQKELEFRVAERTAELMQSNARLQQREQQLQALFDHAVD
AILIADDEGRYVDVNAAACELFGVSRGELLASTIGDFAALEFNFTEAWQHFREQKQMSGE
FQLHRPNGTVRATEFAAVANFIPHRHLSIIRDVSDRQQAKANLQNSEQRLQLALSASSTG
MWDWNLQTNEVVWSESMCSLFNIDPQTFNNRFESFVNFIHPEDREFVEQHLMQSIDQNTI
CNVEFRVVWLDGTVHWASGKGNVFYDEVGKPIRMIGVHQDITERKQAEAKLQKSEQRLKL
ALWAGNTGTWDWNLQTNEVIWSDHLFSLFGLAPDTFDVSYENFLNLIVHPEDRELLHQSA
LRAIEQQVPHDIEFRFLYPDGTVGWSLCKGQVLYDDITGEPLQMIGVNMDITERKNAEEA
VRESNQRLQAIIDNCPAVIYVKDMQERYILVNSEFERITHLTREQVKNKTNVKIFSPKTA
RSLSINDQEILSSRTPVQFEEEIQFEDGLHTYLTVKFPLCDATGEPYAICGVSTDITERK
QAQEQIRQQAALINVATDAIFVRDLANRILFWSRGAENLYGWTAEETVGKLAHELFHKES
SSQLEAAVTTTLEQGSWYGELEQTTKNAQEIIVASRWTLVHNQFGDSPSILVVNTNITEK
KQLELQFYRVQRLESIGTLASGIAHDLNNVFAPIVMIAQLLPSRCKNVDTRTHELFKTLE
TSSKRGSDLVKQILTFARGTEGQRILLQPGHLLKELAKVIQQTFPKSIEIITDIPTNTLW
MVQADPTQLEQVFMNLAVNARDAMPNGGKLTITATNRVIDSTYARMHLESEVGDYIVVTI
SDTGTGIPPEILERIFDPFFTTKEVGKGTGLGLSTVLGIVKNHGGFVEVASQVGQGTEFQ
VFLLRGKGTATETIAKTKLPRGNGELILVVDDETIIQQTAQEALADYNYRILVANDGIEA
IALYVEYQPEISVVLLDMVMPNIDGLTAIRTLRTINPKVKIIASSGLPANEQQAIVAGAN
RFISKPYTTTDLLTTLSDVIGVKE
NT seq 4035 nt NT seq  +upstreamnt  +downstreamnt
atgccatcactttatcctgtggatttacctaccatagagcaggtaatggaatgttaccct
ttaactgtattaccggatactctgctcgttgatgtaattgctctcatgaatccggtaagc
agatgtacaatagtttctgcatctaattttagtagttgtgttttagtagttgaggaaaaa
aagttagtaggtatattcactctacgggatgtagtcaggctcactggcgtaggggtagat
atatccaggaaaaaaatttccgaggtgatgactcagccagtcattagcttgacactagct
gcggctcaaaatgctctcaccgctctagcttttatgcgccagcatcacattcgccatttg
cctgtggtagatgagcaaggacaattgttaggcttgattactcaagacagaatacgtcag
gtggttcaaccagcgcatctgctgaaactgcgatgtgtgacagaggtgatggtaacggaa
attattcatgcactgccaactacatctgtgttggaattatctcagatgatgagcgatcgc
cggatcagttgtgttgtcattgtcgcaccgcaagagacaaaactgattcctgtggggatg
attacagagaaagatattctcaaagtccagttacagggactagatatcgcccaaacccca
gcgcaaaccgtgatgagttcccctgtattcagtattagtccccgtgaatctttgtggact
gttaatctgttgatgcaagcgcgaggggtgcgacggttagtcgtggttggtgaacaaggc
caaatgcaaggactagtgacacaaaccaatctcctgcaagtgcttgatcccttagaaata
gtcaacgtcatccaagccttagaagccaaagttgcagagcaaacatttcaactccagcaa
actaaccagcagttagaagcagaaatcaaacaacgccaccaagttgaggaatcaatgcgc
caaactcaaaaagaattagagtttcgggtggcggagcggacagccgaactaatgcaatct
aatgcgcgtctacaacagcgtgaacagcagttgcaagccttgtttgatcacgctgtggat
gcgatcctgattgcggatgatgagggacgttatgtggatgtcaatgcagcagcttgcgaa
ttatttggtgtatctaggggagaacttttagcctcgacaattggggattttgctgcacta
gaatttaattttaccgaagcttggcaacacttccgtgaacaaaaacaaatgtcgggcgag
tttcaattgcatcgtcccaacggtacagtaagagcaacagaatttgcggcggttgccaat
ttcataccacatcgtcatctttccatcatccgggatgtgagcgatcgccagcaggctaaa
gcaaatctgcaaaacagtgagcaacggctacaactggcactctcagccagcagcacaggt
atgtgggactggaatctgcaaactaatgaggtggtctggtctgagagtatgtgttcttta
tttaatatcgatccccagacattcaacaacaggtttgaatcatttgtaaatttcatccac
cctgaagaccgagaatttgtagaacaacacctgatgcagtctattgatcaaaataccatc
tgtaatgtcgagtttcgggtagtgtggcttgatggtacagtacactgggcaagtggcaaa
ggaaacgtcttctacgatgaagttgggaaaccaatccgcatgattggagtgcatcaggac
attacagaacgcaaacaagctgaggcaaaactgcaaaaaagcgagcaacggctaaaacta
gcactctgggctggtaatactggtacttgggactggaatctgcaaaccaatgaagttatc
tggtctgatcatctgttttctttatttggtttagcccctgatacgtttgatgtcagctat
gaaaatttcttaaatctcattgtccatcctgaagaccgagagttgctgcatcaatcagcg
ttacgagctattgagcaacaagtaccccatgatatcgaattccggtttctttacccagat
ggtacagttggttggtcattatgtaaaggtcaagtattatacgatgacatcacgggtgag
ccactccagatgattggggtgaatatggacattactgagcgtaaaaacgctgaggaagct
gtcagagaaagtaatcaaaggctacaggcgattatagataattgcccggctgttatctat
gttaaggatatgcaggaacggtatattctggtgaattccgaatttgaaagaatcacccac
ctgacacgagagcaagtcaaaaataaaactaatgtaaaaatcttttctcctaaaactgct
cgctccttaagtataaatgatcaagagattctatcttctaggactcctgtgcagtttgag
gaagaaattcaatttgaggatgggctacacacttacttaactgtcaagtttcccctctgc
gatgcgactggtgaaccctatgcgatttgtggtgtttccacagatataacagagcgcaaa
caagcccaagagcaaatccgtcaacaagcagctttaattaatgttgcgacagatgccatt
tttgtccgtgatttagcaaaccgcatattattctggagtcgaggggcggaaaacttatac
ggttggacagcagaggaaactgtggggaaattagcccatgaacttttccataaagaatcc
tcgtctcaattggaagcagctgtaacaaccactctcgaacaaggttcttggtatggagaa
ttagagcaaaccaccaaaaatgctcaagaaattattgttgctagtcggtggacactggta
cacaatcaattcggagattccccatcaatcttagtagttaacaccaacatcactgagaaa
aaacaactagagctacaattttaccgcgttcaacgactggaaagtatcggcactctagcc
agtggcattgcccatgacctcaataatgtgtttgctcccattgtgatgattgcccaactg
ttgccttccagatgcaaaaatgtggatacaaggactcatgaactgttcaaaactctagaa
accagctccaagcgtggctctgatttagtaaaacaaattctcacctttgcccgtggtact
gaaggtcaacgcatcctcctgcaacctggacatttgctcaaagaattagccaaagtcatc
caacagacatttcctaaatccattgaaatcattactgatattccgacaaacaccttgtgg
atggtgcaagctgatcccacccaattagaacaggtgttcatgaacttggcagtcaatgcc
cgtgacgctatgcccaatggtggtaagcttaccatcactgccaccaatcgggtaatcgac
tctacctatgcccgaatgcacctagagtcggaagtaggagactacattgttgtcaccatc
tcagatacaggcacaggaattccgccagaaatcttagaacgcatatttgatccctttttt
accacgaaagaagtcggtaaaggtacagggctaggactatcaacggttttaggtatcgtc
aagaaccacggtggttttgtagaagtggcaagtcaggtaggtcaaggcacagaatttcag
gtgttcttactcagaggaaaaggaacagcaaccgagaccatagcaaaaacaaaattgcct
agaggtaatggcgagttgattttagttgtcgatgatgaaacgatcatccaacaaactgca
caagaagccctggcggattataactatagaattttggtagctaacgatggcattgaggcg
atcgcgctctatgtcgaatatcaaccagaaatcagtgttgtcttgctagatatggttatg
cccaacatagacggattaaccgccatccgcactctacgcaccatcaaccccaaagtcaag
attattgcctctagtggcttacccgccaacgagcaacaagcgattgtggctggtgcaaac
agatttatatctaagccctacacaaccacagatttattgactactctatcggatgtcatc
ggggttaaagagtag

DBGET integrated database retrieval system