KEGG   Anabaena variabilis: Ava_0239Help
Entry
Ava_0239          CDS       T00277                                 

Definition
(GenBank) Response regulator receiver domain protein (CheY) (EC:3.1.1.61)
Organism
ava  Anabaena variabilis
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
305373..305771
Genome map
AA seq 132 aa AA seqDB search
MTNLTMNNKRILVVDNEQYIQEVAKICLETVAGWEVVTASSGQEGINKAETYQPDAILLD
VMMPDMDGIATFEKLQANSVTQKIPVILLTAKIQASDRRRYSQLGMVSAIAKPFNPLELA
GQVATALGWNLA
NT seq 399 nt NT seq  +upstreamnt  +downstreamnt
atgactaatttaactatgaacaacaaacgaattttagtggtcgataacgagcagtatatt
caagaagttgccaagatttgcttggaaacagttgcaggctgggaggttgtcacagccagt
tcaggacaagaaggcataaataaagccgagacttaccaaccagatgcaattttactagat
gtgatgatgccggatatggatggtatcgctacatttgagaaactgcaagccaattccgtc
acccaaaaaataccagtaatcttattaaccgccaaaatccaagcctctgaccgtcgccgc
tactcccaattggggatggtgagtgcgatcgctaaacccttcaatccgctagaattagct
ggtcaagtagccaccgcccttggttggaatttagcctga

DBGET integrated database retrieval system