KEGG   Trichormus variabilis: Ava_0252Help
Entry
Ava_0252          CDS       T00277                                 

Definition
(GenBank) Ribokinase
  KO
K00852  ribokinase [EC:2.7.1.15]
Organism
ava  Trichormus variabilis
Pathway
ava00030  Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:ava00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Ava_0252
Enzymes [BR:ava01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Ava_0252
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PfkB Phos_pyr_kin Carb_kinase
Motif
Other DBs
NCBI-ProteinID: ABA19878
JGI: Ava0252
CyanoBase: Ava_0252
CYORF: Ava_0252
UniProt: Q3MGK8
Position
323773..324696
Genome map
AA seq 307 aa AA seqDB search
MSIIVFGSINIDLVATAPKLPIAGETLLGEDFFKVPGGKGANQAVAVAKLGVPTQMVGRV
GAHGFGAELMENLQDAGVQTDNIFVDETASSGVAMITVAHDGENQIVVIPGANGRVNQAD
VERLSYILPTATALLLQLEIPITAVIAAAQAARSNNITVILDPAPAPSDLPAELYPLIDI
ITPNEVEAGQIVGFPVDGEEAARKAAGVLLQRGVKSAIVKLGAKGVVCATDKETFFVPAF
FVDTVDTVAAGDAFNGGLATALYSGLSLHQAVIWGAAAGALAATKLGAQTSLPDKLTFEA
FLKERGL
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgagcattatcgtcttcggtagcatcaatatagatttagttgccacagcacccaagtta
ccaattgcaggagaaaccttactgggagaagactttttcaaggttcctgggggtaaaggt
gcaaaccaagctgtagcagtagccaaactgggagttcctacccaaatggtgggacgtgtt
ggcgcacatggttttggtgcagaactgatggaaaatctgcaagatgctggcgtacaaact
gacaatatttttgtagatgaaactgccagttctggagtggcgatgattaccgtcgctcat
gatggtgaaaatcaaatagttgtcattcctggtgctaatgggagagtcaatcaagccgat
gtagaacgattatcatacatattacccacagccacagccctgctattacaattagaaatt
cctataaccgccgttatcgcagctgcccaagccgccagaagtaacaatatcacagtaatt
ttagatcccgcacctgcaccatcagatttaccagcagaactttaccctttgattgatatc
attaccccaaatgaagtggaagcgggacaaatcgtaggttttcccgtagatggagaagaa
gcagcgcgaaaggcagccggggtgttattgcaaagaggcgtgaaaagtgcgatcgttaaa
ctgggcgctaaaggtgttgtttgtgccacagacaaagagaccttttttgtcccagccttc
tttgtggatacagttgatactgtagcggctggtgatgcctttaatggtggtttggcaaca
gcactttattctgggctttccttacatcaggcagttatttggggtgcggcggctggtgct
ttagctgcaacaaaattaggcgcacaaacttccttgcctgacaagttgacatttgaggct
ttcctcaaggaaaggggtttgtga

DBGET integrated database retrieval system