KEGG   Anabaena variabilis: Ava_0437Help
Entry
Ava_0437          CDS       T00277                                 

Definition
aromatic amino acid beta-eliminating lyase/threonine aldolase (EC:2.8.1.7)
Orthology
K04487  
cysteine desulfurase [EC:2.8.1.7]
Organism
ava  Anabaena variabilis
Pathway
Thiamine metabolism
Metabolic pathways
Sulfur relay system
Brite
KEGG Orthology (KO) [BR:ava00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    Ava_0437
 Genetic Information Processing
  Folding, sorting and degradation
   04122 Sulfur relay system
    Ava_0437
Enzymes [BR:ava01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.1  Sulfurtransferases
    2.8.1.7  cysteine desulfurase
     Ava_0437
Transfer RNA biogenesis [BR:ava03016]
 Eukaryotic Type
  tRNA modification factors
   Thiolation factors
    Ava_0437
 Prokaryotic Type
    Ava_0437
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
557186..558352
Genome map
AA seq 388 aa AA seqDB search
MSNRPIYLDCHATTPLDEQVLAAMLPYFTEKFGNPASIGHIYGWEAEAAVKQAREILAAA
INASPEEIVFTSGATEANNLAIKGVAEAYFQKGQHIITVATEHHAVLDPCEYLKTLGFEI
TILPVQADGLIDLAQLEKALRPETILVSVMAANNEIGVLQPLAEIGEICRSHNIIFHTDA
AQAIGKIPLDVQAMNIDLMSLTAHKVYGPKGIGALYVRRRNPRVQLAPQQHGGGHERGMR
SGTLYTPQIVGFAKAVEIALAEQTMENQRLTQLRDRLWSQLAQLEGIHLNGHPTQRLAGN
LNISIEGVDGAALQLGLQPVVAVSSGSACSSTKTAPSHVLTALGSPEKLAYASIRFGIGR
FNTAEEIDIVAKYAIATIQSLRKQASLV
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgtctaatcgtcctatatatcttgattgtcacgctaccacacctctagatgaacaagta
ttagcagcaatgctaccttactttacggaaaaatttggcaacccggctagtatcggccat
atttatggttgggaagcagaggcggctgtgaaacaagcacgggaaattttagcagcagca
attaacgctagtccagaagaaattgtctttactagtggggctacagaagcgaataattta
gcgattaaaggtgtggctgaggcttattttcaaaaaggtcagcatattatcactgttgcc
actgaacatcatgctgtacttgacccttgtgaatatttaaaaacccttggttttgagata
actattttgccagtccaagcagatggattaattgatttagcccaattagaaaaagcgttg
cgtcctgagacaattttagtatcggtgatggcggctaataacgaaattggggtgttgcaa
cctttggcagaaattggggaaatatgccgcagtcacaatataatttttcacacagatgca
gcccaagctattggcaaaattcctctcgatgtgcaagcgatgaacatcgatttgatgtct
ctgacagcccacaaagtttacgggcctaagggtattggtgcattatacgtccgcaggcgc
aatcccagagtccaactcgcaccccagcagcatggcggcggacatgaacggggaatgcgt
tctgggacgttgtatacaccgcaaattgtcggttttgccaaagctgtagaaatcgccctc
gcagaacagacaatggaaaatcagcgccttacccagctaagggatagattgtggtcacaa
cttgcacaattggaaggaatacacctcaacggacatcccacccagagactagccggaaac
ttgaatatcagcattgaaggggtggacggtgctgcactccagttgggtttacagcctgtt
gtggcggtgtcttctggttctgcttgttcctccaccaaaactgcgccctcccacgtcctc
acagctttaggaagtccagaaaaactagcctatgcttctattcgcttcggtattggacgc
tttaatacagcagaagaaattgatatagtagcgaaatatgcgatcgctactattcaaagt
ttacgtaaacaagcaagtttggtatag

DBGET integrated database retrieval system