KEGG   Anabaena variabilis: Ava_0437Help
Entry
Ava_0437          CDS       T00277                                 

Definition
aromatic amino acid beta-eliminating lyase/threonine aldolase (EC:2.8.1.7)
Orthology
K04487  
cysteine desulfurase [EC:2.8.1.7]
Organism
ava  Anabaena variabilis
Pathway
Thiamine metabolism
Sulfur relay system
Class
Metabolism; Metabolism of cofactors and vitamins; Thiamine metabolism [PATH:ava00730]
Genetic Information Processing; Folding, sorting and degradation; Sulfur relay system [PATH:ava04122]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
557186..558352
Genome map
AA seq 388 aa AA seqDB search
MSNRPIYLDCHATTPLDEQVLAAMLPYFTEKFGNPASIGHIYGWEAEAAVKQAREILAAA
INASPEEIVFTSGATEANNLAIKGVAEAYFQKGQHIITVATEHHAVLDPCEYLKTLGFEI
TILPVQADGLIDLAQLEKALRPETILVSVMAANNEIGVLQPLAEIGEICRSHNIIFHTDA
AQAIGKIPLDVQAMNIDLMSLTAHKVYGPKGIGALYVRRRNPRVQLAPQQHGGGHERGMR
SGTLYTPQIVGFAKAVEIALAEQTMENQRLTQLRDRLWSQLAQLEGIHLNGHPTQRLAGN
LNISIEGVDGAALQLGLQPVVAVSSGSACSSTKTAPSHVLTALGSPEKLAYASIRFGIGR
FNTAEEIDIVAKYAIATIQSLRKQASLV
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgtctaatcgtcctatatatcttgattgtcacgctaccacacctctagatgaacaagta
ttagcagcaatgctaccttactttacggaaaaatttggcaacccggctagtatcggccat
atttatggttgggaagcagaggcggctgtgaaacaagcacgggaaattttagcagcagca
attaacgctagtccagaagaaattgtctttactagtggggctacagaagcgaataattta
gcgattaaaggtgtggctgaggcttattttcaaaaaggtcagcatattatcactgttgcc
actgaacatcatgctgtacttgacccttgtgaatatttaaaaacccttggttttgagata
actattttgccagtccaagcagatggattaattgatttagcccaattagaaaaagcgttg
cgtcctgagacaattttagtatcggtgatggcggctaataacgaaattggggtgttgcaa
cctttggcagaaattggggaaatatgccgcagtcacaatataatttttcacacagatgca
gcccaagctattggcaaaattcctctcgatgtgcaagcgatgaacatcgatttgatgtct
ctgacagcccacaaagtttacgggcctaagggtattggtgcattatacgtccgcaggcgc
aatcccagagtccaactcgcaccccagcagcatggcggcggacatgaacggggaatgcgt
tctgggacgttgtatacaccgcaaattgtcggttttgccaaagctgtagaaatcgccctc
gcagaacagacaatggaaaatcagcgccttacccagctaagggatagattgtggtcacaa
cttgcacaattggaaggaatacacctcaacggacatcccacccagagactagccggaaac
ttgaatatcagcattgaaggggtggacggtgctgcactccagttgggtttacagcctgtt
gtggcggtgtcttctggttctgcttgttcctccaccaaaactgcgccctcccacgtcctc
acagctttaggaagtccagaaaaactagcctatgcttctattcgcttcggtattggacgc
tttaatacagcagaagaaattgatatagtagcgaaatatgcgatcgctactattcaaagt
ttacgtaaacaagcaagtttggtatag

DBGET integrated database retrieval system