KEGG   Anabaena variabilis: Ava_0933Help
Entry
Ava_0933          CDS       T00277                                 

Gene name
glk
Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
ava  Anabaena variabilis
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:ava00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Ava_0933 (glk)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Ava_0933 (glk)
   00052 Galactose metabolism
    Ava_0933 (glk)
   00500 Starch and sucrose metabolism
    Ava_0933 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    Ava_0933 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Ava_0933 (glk)
   00524 Butirosin and neomycin biosynthesis
    Ava_0933 (glk)
Enzymes [BR:ava01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Ava_0933 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(1126533..1127561)
Genome map
AA seq 342 aa AA seqDB search
MTLLLAGDIGGTKTILRLVEVSNSSELHNIYEESYQSGDFPDLVPMVQQFLVKANIPSHP
EKACFAIAGPVVNNTAKLTNLVWFLDTERLAQELSIPFISLINDFAAVGYGIFGLSKQDL
FTLQAGKHQTEAPIAIIGAGTGLGQGFLIKQGNQYQVFPSEGGHADFAPRNELEFQLLKY
LLDKHDIQRVSVERVVSGQGVVAIYQFLRDRKLAIESPEIAQVVRTWEQQAGQAEKTVDP
GAAIGKAAVQGSDRLSEQTLQLFIDAYGAEAGNLALKLLPYGGLYIAGGIAPKVLPLIEN
SNFLLNFSQKGRMRPLLEEIPVHIILNPQVGLIGAALCAARL
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgaccttattgttagcaggagatatcggcgggacgaaaactattttgcgattggtagaa
gtatcaaattcgtcggaactgcacaatatttatgaggaaagttaccagagtggggatttt
cccgatttagtgccgatggtgcagcaatttttagtcaaggctaatatacctagtcatccc
gaaaaggcttgctttgcgatcgccggcccagtggtgaataatactgccaagctgaccaac
ttagtctggtttttggatactgaacggctagcacaagaattaagtatccccttcatttcc
ctcattaatgattttgctgctgttggctatgggatttttgggttaagtaaacaagatttg
ttcaccttacaagctggtaaacatcaaactgaagcgcctattgctattattggtgctggt
actggattaggacaaggatttttaattaaacagggaaaccagtatcaagttttcccatcg
gaaggtggacacgctgactttgccccccgcaacgagttagagtttcagttattgaaatat
ctgctggataaacatgatatccagcgtgtttctgtggaacgggtggtttctggacagggg
gttgtcgccatttatcaatttttacgcgaccgcaaattagcgatagaatccccagaaatt
gcccaagttgtccgcacttgggaacaacaagcaggacaggctgaaaaaaccgttgatcct
ggtgcagctattggtaaagccgcagtccaaggaagcgatcgcctttccgaacaaacccta
caattatttattgatgcctatggcgcagaagcgggaaatcttgccctcaaactcctacca
tacggcggtttgtacattgcgggtgggattgcgcctaaagtcttgccattgattgaaaat
agcaatttcttgcttaatttcagccaaaaaggcagaatgcgtcctctgctagaagaaata
cccgtgcatatcattcttaacccacaagtgggactcataggtgctgctttgtgtgctgct
aggttataa

DBGET integrated database retrieval system