KEGG   Anabaena variabilis: Ava_0949Help
Entry
Ava_0949          CDS       T00277                                 

Definition
7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
ava  Anabaena variabilis
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ava00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Ava_0949
Enzymes [BR:ava01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     Ava_0949
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(1144197..1144751)
Genome map
AA seq 184 aa AA seqDB search
MSVENKKNSPEIFTKHDAEFKPKIQASAIALGSNIGDSLAILEAATAELAAIAGIQLTAK
SSWYITKAVGPPQPDYINGCISLQVQMSPLELLETLLAIEQKFGRVRQERWGPRSLDLDL
LLYDDLIIDTPTLQIPHPRMQERAFVLVPLAEIAPDWLEPISGYVIRELVKKVDCSDVHL
LKGS
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
ttgtctgttgagaacaaaaaaaatagcccagaaatattcacaaagcacgatgcagagttt
aaaccaaagatacaggcaagtgcgatcgctcttggtagtaatatcggtgattctttagca
atattagaagctgctacagcagagttagcggcgattgcaggtattcaactaacagcaaaa
tccagttggtatataactaaagccgtggggccgccacaaccagactacatcaatggttgc
atcagcttacaagtacagatgagtccgctagaattgctagaaacattactagcaatagaa
cagaaatttgggcgggtgcgtcaagaacgctgggggccgcgatcgctagacttggatttg
ttattgtatgatgacttaattattgatacaccaactctccaaataccccatccgcgaatg
caagagcgagcctttgttttagtacctctagcggagattgcgcccgactggttagaacca
atttccggatatgtaattagagagctggtaaaaaaggtagactgttctgatgtacatttg
ttaaagggcagttaa

DBGET integrated database retrieval system