KEGG   Trichormus variabilis: Ava_0966Help
Entry
Ava_0966          CDS       T00277                                 

Definition
(GenBank) Glutaminase
  KO
K01425  glutaminase [EC:3.5.1.2]
Organism
ava  Trichormus variabilis
Pathway
ava00220  Arginine biosynthesis
ava00250  Alanine, aspartate and glutamate metabolism
ava00471  D-Glutamine and D-glutamate metabolism
ava01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ava00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Ava_0966
   00220 Arginine biosynthesis
    Ava_0966
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    Ava_0966
Enzymes [BR:ava01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     Ava_0966
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glutaminase DUF1811 DUF5461
Motif
Other DBs
NCBI-ProteinID: ABA20590
JGI: Ava0966
CyanoBase: Ava_0966
CYORF: Ava_0966
UniProt: Q3MEJ6
Position
1168954..1169958
Genome map
AA seq 334 aa AA seqDB search
MSDQANQGDLEIRPSPLLTVINDLHSKYKSLKEGIVANYIPELAKVNPDLFSISIVTVDG
QVYQVGDYQQLFTIQSISKVFAYGLALEDHGRDYVLTRVGVEPTGEAFNSIILDEQSKRP
YNPMVNAGAIATTSLIKGAGATERLNRVLEMFRRYIGHDVFVDISVFTSERSTGHRNRAM
AHLMLNFGMIDRNLEEALDLYFQQCAVMVNCHDLAVMAATLANRGVNPVTGEQAVNSRYI
KDILSVMYTCGMYNFAGEWAYKVGIPAKSGVCGGIMAVVPNQMGIAVFSPPLDIRGNSVR
GVKVCEELSQQLGLHLFECVKVENGKWGVGNCEC
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgagcgatcaagccaatcaaggagatttagaaatacgtccctctcccctattaacggtg
atcaacgatttgcattctaaatacaagtcactgaaagaagggatagtagcgaactacata
ccagaactggccaaagtcaacccagacctgtttagtatttccatcgttacagtggacggt
caggtttatcaggtaggagattatcaacaactatttactatccagtctatttctaaagtt
ttcgcctacggactagcactagaagatcatggacgggattatgtgttgactagagttggt
gtagaaccaacgggtgaagcatttaactccattattttagatgagcaatcgaagcgacct
tataacccaatggtaaatgctggggcgatcgccaccaccagtttaatcaaaggggctggg
gcaacggaacgcctcaatcgagtactggaaatgtttcgccgatatattggtcatgatgta
tttgttgatatttccgtatttacctccgaacgcagtacaggacaccgtaatcgggcgatg
gcacatctcatgctcaactttggcatgatagatagaaatctagaagaagcattagaccta
tattttcagcaatgtgccgtgatggttaactgtcacgacctggccgtgatggccgccacc
ttggcgaacaggggggtgaacccagtcacaggagaacaagcggtaaatagtagatatata
aaagatatcctcagcgttatgtacacctgtgggatgtacaactttgcaggagagtgggct
tataaagtcggtattccggcaaaaagcggtgtttgtgggggaattatggcagttgtcccc
aatcagatgggaattgccgtgttttctccacctttagatattcgaggtaacagtgtgcga
ggagtgaaggtgtgtgaagaactgtctcagcagttgggcttacatctatttgaatgtgtg
aaagtggagaatggaaaatggggagtagggaattgtgagtgttga

DBGET integrated database retrieval system