KEGG   Trichormus variabilis: Ava_1206Help
Entry
Ava_1206          CDS       T00277                                 

Definition
(GenBank) acetyl-coenzyme A synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
ava  Trichormus variabilis
Pathway
ava00010  Glycolysis / Gluconeogenesis
ava00620  Pyruvate metabolism
ava00640  Propanoate metabolism
ava00680  Methane metabolism
ava01100  Metabolic pathways
ava01110  Biosynthesis of secondary metabolites
ava01120  Microbial metabolism in diverse environments
ava01130  Biosynthesis of antibiotics
ava01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ava00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Ava_1206
   00620 Pyruvate metabolism
    Ava_1206
   00640 Propanoate metabolism
    Ava_1206
  Energy metabolism
   00680 Methane metabolism
    Ava_1206
Enzymes [BR:ava01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Ava_1206
Lipid biosynthesis proteins [BR:ava01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Ava_1206
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: ABA20830
JGI: Ava1206
CyanoBase: Ava_1206
CYORF: Ava_1206
UniProt: Q3MDV6
Position
complement(1487044..1489017)
Genome map
AA seq 657 aa AA seqDB search
MSQPTIESILQEKRLFHPSAEFSQNAQIKSLEDYQRLYDKAKADPQKFWAELAETELHWF
QKWDTVLDWQAPFAKWFVGGKINISYNCLDRHLTTWRKNKAALIWEGEPGDSRTLTYAQL
HREVCQFANVLKQLGVQKGDRVGIYMPMIPEAAIAMLACARIGAPHSVVFGGFSAEALRD
RLIDAQAKVVVTADGGWRKDAIVPLKEQVDKALADGAVPSVENVLVVKRTGQDIYMQLGG
RDHWWHDLQKGASADCPAEPMDSEDLLFVLYTSGSTGKPKGVVHTTGGYNLYTHMTTKWI
FDLQDTDVYWCTADVGWITGHSYIVYGPLSNGATTLMYEGAPRASNPGCFWDVIEKYGVN
IFYTAPTAIRAFIKMGEHHPNARNLSSLRLLGTVGEPINPEAWMWYHKVIGGDRCPIVDT
WWQTETGGIMITPLPGAISTKPGSATLPFPGILADIVDLDGNTVPQNEGGYLAVRYPWPG
MMRTVYGDPERFRRTYWEHIPPKDGNYTYFAGDGARKDEDGYFWVMGRVDDVLNVSGHRL
GTMEVESALVSHPAVAEAAVVGKPDDLKGEEVVAFVTLEGTYQASDDLSKVLKQHVVQEI
GAIARPGEIRFTDALPKTRSGKIMRRLLRNLAAGQEVSGDTSTLEDRSVLDKLREGA
NT seq 1974 nt NT seq  +upstreamnt  +downstreamnt
atgtctcagccaactatagagtcaattctgcaagaaaaacgtttatttcatcccagtgcc
gagttttcccaaaatgcccagattaaaagtctagaagattaccaacgtctctacgacaaa
gccaaagctgatccgcaaaaattttgggcagaattagccgaaacagaactgcactggttc
caaaaatgggacacagtattagattggcaagcacctttcgctaagtggtttgtgggtggg
aagattaacatttcctacaactgtttagatagacatctcacaacttggcggaaaaataaa
gctgctttgatttgggaaggggaaccaggggattcccgtactttaacttatgcccaatta
catcgggaagtttgccagttcgccaacgtcttgaaacaactgggagtgcagaaaggcgat
cgcgtcggtatttatatgccgatgattcccgaagcggcgatcgccatgttagcctgcgcg
agaattggcgcacctcatagcgtggtatttggtgggttcagtgcggaagccttgcgcgat
cgcttaattgatgcccaagccaaggtagtagttacagctgatggtgggtggcgtaaagat
gcgatcgttcccttgaaagaacaggtagacaaagccttggctgatggtgctgttccatct
gtagaaaacgtcctggttgtcaagcgtaccggacaagatatttatatgcagttgggagga
cgagatcattggtggcacgatttacaaaaaggcgcatccgccgactgtcccgccgaacca
atggatagcgaagacttgctatttgtcctctacacttccggtagcacaggcaaacccaaa
ggcgttgtccataccactggtggttataacttatatacccacatgaccaccaaatggatt
ttcgacctacaagacacagatgtatattggtgtaccgccgatgtaggttggattactgga
catagttacatagtctacggccccctctccaacggtgcaaccacactgatgtatgaaggt
gcgcctcgtgcctccaatcctggttgtttctgggatgtaattgaaaaatacggcgtgaac
attttctacaccgcacccaccgcaattcgcgcctttattaaaatgggtgaacaccatccc
aacgcccgcaacctttcttccttaagattattaggaactgttggtgaaccaattaaccca
gaagcttggatgtggtatcacaaagttattggtggcgatcgctgccccatcgttgatact
tggtggcaaactgaaactggcggtatcatgattacccctctaccaggggcaatttccact
aaacccggttccgctacccttcccttccctggcatcctggccgacatagttgatttagat
ggtaacactgtaccccaaaacgaaggtggttacttagcagtgcgttatccctggccggga
atgatgcggactgtttacggcgatcctgaacgcttccgccgcacctactgggaacatata
ccccccaaagatggcaactatacttactttgctggcgatggcgcgagaaaagatgaagac
ggctatttctgggtaatgggacgagtggatgatgtattgaatgtgtcaggacaccgcctc
ggcacaatggaagtagaatcagccctagtttctcacccagccgttgccgaagcagcagta
gtgggtaaaccagatgacttaaaaggcgaagaagtggtagcttttgtcaccctagaagga
acttatcaagccagcgatgacttgagtaaggtactcaaacaacacgtagttcaagaaatc
ggggcgatcgctcgtcctggggaaattcgctttaccgacgcattacccaagacgcgatcg
ggtaaaatcatgcggcgcttactgcgaaatctcgccgccggacaagaagtttctggcgat
acttccactctggaagatagaagtgttttagataaattacgggaaggtgcgtaa

DBGET integrated database retrieval system