KEGG   Anabaena variabilis: Ava_1218Help
Entry
Ava_1218          CDS       T00277                                 

Definition
3-beta hydroxysteroid dehydrogenase/isomerase (EC:1.1.1.219)
Orthology
K00091  
dihydroflavonol-4-reductase [EC:1.1.1.219]
Organism
ava  Anabaena variabilis
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
1501931..1502914
Genome map
AA seq 327 aa AA seqDB search
MRVFVTGATGFVGANLVRLLLQQGYTVKTLVRPQSNLGNLQGLDVEIVEGDFDNQYLWRQ
MSGCRYLFHVAAQYSLWQKDRDLLYQNNVLGTFQVLEAAQKAGIERTVYTSSVAAIGVNP
SGAIADETYQSPVDKLIGHYKKSKFLAEQEAVQAAAKGQDVVIVNPSTPIGPWDIKPTPT
GDIILRFLRRQMPAYVNTGLNLIDVRDVAWGHLLALEKGKSGDRYILGHQNLSLKQLLEK
LAEITGLSAPQWTVPGWLPLSVAWMEEKILAPLGKPPSVPIDGVRMAQQTMYYDASKAVK
ELGLPQSPVDIALKDAVNWFVSQGYVK
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgcgggtctttgtcacaggggctacgggttttgtgggtgccaatctagtgcgattgctg
ctgcaacaggggtacacagtcaaaaccctagtccgtcctcagagcaatctgggtaattta
cagggtttagatgtggaaattgtcgaaggggattttgataatcaatacctttggcgacag
atgtctggttgtcggtatctgtttcatgtcgcagcccaatactccctgtggcaaaaagac
cgggatttactttatcaaaacaacgtcctcggtacttttcaggtgttagaagcagcccaa
aaagcgggaattgaacgtactgtttacaccagttctgtagccgccattggggtaaatccc
tctggtgcaattgccgatgaaacctatcaaagcccggtagataagctaattggacattac
aaaaaatccaagtttttagcagaacaggaagccgtacaggccgcagccaagggacaagat
gtggtcatcgttaaccccagcacccccatcggcccttgggatatcaaacccacacccacc
ggcgacattattctccggttcctgcggcgacaaatgcccgcctatgtcaataccgggctg
aatttaatcgatgtgcgggacgtagcttggggacatttactggccttggaaaaagggaaa
agtggcgatcgctatatcttaggacatcagaacctcagcctcaagcaactactggagaaa
ctggcagaaatcacaggtttatccgcaccccaatggactgtcccaggctggttaccccta
agcgtcgcctggatggaagaaaagatcctcgcacctttgggaaaacctccttcagtccct
atagatggtgtccgtatggctcaacaaaccatgtactacgatgcctcaaaagccgtcaaa
gaattaggtttaccccaatctccagtcgatattgccctgaaagatgcggtgaattggttt
gtttcccaaggttacgtcaagtga

DBGET integrated database retrieval system