KEGG   Anabaena variabilis: Ava_1271Help
Entry
Ava_1271          CDS       T00277                                 

Definition
formamidopyrimidine-DNA glycosylase (EC:3.2.2.23 4.2.99.18)
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
ava  Anabaena variabilis
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:ava03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
1560432..1561265
Genome map
AA seq 277 aa AA seqDB search
MPELPEVETVRRGLNQLTLNRKITGGDVLLHRTIAHPFSVGDFLNGITGDSISAWHRRGK
YLLASTTSAAWLGVHLRMTGQLLWLNQDEPLHKHTRVRIFFEDQQELRFVDQRTFGQMWW
VSSGMAVESVITGLAKLAVDPFSPEFTVEYLANKLHNRRRPIKTALLDQSVVAGLGNIYA
DEALFKSGVLPETLCTEVQLKQIELLRTAIIQVLETSIEAGGTTFSNFLNVKGVNGNYGG
VAWVYNRAGEPCKVCGDVIQRIKLGGRSSHFCRQCQV
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atgcctgaattgcctgaagttgaaacagtacggcggggtttaaaccaactaaccctaaac
cgaaaaattacgggtggagatgtgttgcttcatcgcaccatcgctcaccctttttctgtt
ggtgattttttgaatggaattaccggtgattccattagtgcttggcatcgtcgcggtaaa
tatctcctcgcttccactacttccgccgcttggctaggtgtgcatctgaggatgactggt
caattactgtggttaaaccaagatgagcctttacataagcacacgcgggtaagaatattt
ttcgaggatcaacaggaattacgctttgttgaccaacgaactttcggtcaaatgtggtgg
gtttcatcgggaatggctgtagaaagcgtgattactggtttagctaaacttgccgtagat
cccttttcacctgaatttactgttgagtaccttgctaataagctgcataatcgtcgccgt
cccataaaaacagcactattagaccagtcggttgttgcaggattaggtaacatctatgct
gacgaagcattgtttaaaagtggtgtgttaccagaaactctatgtacagaagtgcagtta
aagcaaattgagcttttgaggacggcaattattcaagttttggaaaccagtattgaggct
ggtggtacaacttttagtaattttctcaacgttaaaggggtcaacggtaattatggtggt
gtcgcctgggtgtataaccgtgcaggggaaccatgtaaagtttgtggtgatgtaattcag
cgcatcaagctaggtggaagatccagccatttttgtcgccagtgtcaagtttag

DBGET integrated database retrieval system