KEGG   Trichormus variabilis: Ava_1300Help
Entry
Ava_1300          CDS       T00277                                 

Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
ava  Trichormus variabilis
Pathway
ava00900  Terpenoid backbone biosynthesis
ava01100  Metabolic pathways
ava01110  Biosynthesis of secondary metabolites
ava01130  Biosynthesis of antibiotics
Module
ava_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:ava00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Ava_1300
Enzymes [BR:ava01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     Ava_1300
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_reductoisom DXPR_C DXP_redisom_C
Motif
Other DBs
NCBI-ProteinID: ABA20924
JGI: Ava1300
CyanoBase: Ava_1300
CYORF: Ava_1300
UniProt: Q3MDL2
Position
1600648..1601844
Genome map
AA seq 398 aa AA seqDB search
MKSITLVGSTGSIGTQTLDIVSQYPDQFRIVGLAAGSNVEMLAEQIRQFRPQIAAISAAE
KLPALQAAIKDLDPQPILLGGEAGVIEVARYGDAETVVTGIVGCAGLLPTIAAIEAGKDI
ALANKETLIAGGPVVLPLVEKHGVKLLPADSEHSAIFQCLQGVPKGGLRKILLTASGGAF
RDWDVERLAEVTVADALKHPNWSMGRKITVDSATLMNKGLEVIEAHFLFGLDYQDIEIVI
HPQSIIHSLIELQDTSVLAQLGWPDMRLPLLYALSWPERIYTDWEPLNLVKAGNLTFREP
DHQKYPCMQLAYAAGRAGGSMPAVLNAANEQVVALFLDEKIKFLDIPRCIELVCDRHQND
NCANPSLDDILAADQWARQEVLTATKNLASQPQIISVN
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaagtattactcttgttggttccactggctcaattggtactcagactctagatatc
gtgagtcagtacccagatcagtttcggattgtggggttggcggcgggaagcaatgtagaa
atgttggcagaacagattcgccagttccgtccccaaatagcagcgatttctgccgccgaa
aaattaccagcactgcaagcagctattaaagaccttgatccccaacctattttactaggg
ggcgaagccggagtgatcgaagttgctcgttacggtgatgccgaaacagtggtgacaggt
attgtcggttgtgctggtttactgccaacaatcgccgccattgaagctggtaaagacatt
gccttagcaaacaaagaaactctcatcgccggcgggcctgtagtcttacccttagtagaa
aaacacggcgttaaattattgccagccgattccgaacattctgccatcttccaatgcctc
caaggtgtaccaaaaggcggcttaaggaagattttactcacggcttccggtggtgctttt
cgggattgggatgtggaaagattagcagaagtaacagtggccgatgccctaaaacatcct
aactggtcaatggggcgaaaaattactgtagactcagccaccctgatgaacaaaggttta
gaagtaattgaggctcattttctgtttgggttagattatcaagatatcgaaattgtcatc
catccccaaagtattattcattcactaattgagctgcaagatacctcagttttagcccaa
ctcggctggccggatatgcgcttacctttgctatatgctttgtcttggccggaacgcatc
tacactgactgggaacccttaaatttagtcaaagctggcaatctcaccttccgtgaacca
gaccatcaaaagtatccttgtatgcagttagcttatgcggctggtagggcgggtggttcc
atgccggcagtgttaaatgctgctaatgaacaggttgtagcattattcctagatgagaaa
atcaaatttttagatattccccggtgtatcgaattagtgtgcgatcgccatcaaaatgat
aactgtgcaaatccttctttagatgatattttggcagcagatcaatgggcaagacaagaa
gttttaacagctactaaaaatttagcaagccaacctcagataatttccgtcaactaa

DBGET integrated database retrieval system