KEGG   Anabaena variabilis: Ava_1373Help
Entry
Ava_1373          CDS       T00277                                 

Definition
glycoside hydrolase family protein (EC:3.2.1.8)
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
ava  Anabaena variabilis
Brite
Enzymes [BR:ava01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.8  endo-1,4-beta-xylanase
     Ava_1373
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
1693076..1694224
Genome map
AA seq 382 aa AA seqDB search
MFHRRKFLKRAGYTTLSAFLTMGFLQRDKQRDIRSTDIAAINTNFPLQQLAAAKGKRYGA
AVDSETLKKYPDYAKLIARECSIVTPNGELKWNATEPQPGYFTFAAADAIANFCQKNNLK
MHGHTLFWNMAKPDWLPYPPTLPMIERHFNGVMGHYRHSQVLTSWDIANEIIAYSEDEAK
ASTYGLHKGVKPELIRDVFLIAASIDSSKKFYLNDFSIEGDTWKSRYFLKMIEYLKNNGA
KIDGAGIQSHLWFSTNYPFDEKGFVGVLKRLKELEVKPVITELDIIIDTPLPDTIEKLDQ
MVADSYKRYLDLCFANGVDTIITWGITDRHSWIRHPDWMPQKFKGNPSYHKFLRPLPYDE
NLKPKLARKAIAQSFIKAAASI
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgttccatcggagaaaatttctaaagagagcaggatacacaactctatctgctttcttg
acgatggggtttttacaaagggataaacagagggatattcgtagtacggatattgcggca
ataaatacgaattttccgttgcagcaattagctgctgccaaaggaaaacgctatggtgca
gcagttgacagtgaaactttaaaaaaatatcccgactacgcaaaattaattgcccgtgaa
tgttcaattgtgacacccaatggcgaattaaagtggaatgccactgaaccgcagccagga
tattttacttttgcagcagctgatgcgatcgccaacttctgccaaaagaataacttgaaa
atgcacggacataccctgttctggaacatggcaaaaccagactggcttccttaccccccc
actctacccatgatcgaacggcactttaacggcgtgatggggcattatcgccatagtcag
gttttaacatcttgggatatcgctaatgaaattattgcctacagtgaagacgaagctaag
gcctctacctatggcttacataaaggcgtaaaaccagaattaattcgagatgtgttttta
atcgccgcttcgattgatagcagcaagaaattttacctcaatgatttctccattgaaggt
gatacctggaaatccaggtatttcttaaaaatgattgagtatctcaagaataatggcgcg
aagatagatggagcaggtatccagtcccatctgtggttttctaccaattatccttttgat
gaaaaaggatttgttggtgttttaaaaaggctcaaagaactggaagttaaaccagtaatt
accgaactagatattattattgatacccctctaccagacactatcgaaaagctcgatcaa
atggtggcagactcttataagcgatatcttgacttatgctttgccaatggagtcgatacc
atcattacctggggtattactgatcgccatagctggatacgtcaccctgattggatgccg
caaaaatttaagggaaatcccagctaccataagtttttgcgtccacttccctacgacgag
aatctgaaacctaaacttgctcgtaaagcgatcgcccaatcttttatcaaggctgctgct
tcaatatga

DBGET integrated database retrieval system