KEGG   Trichormus variabilis: Ava_1373Help
Entry
Ava_1373          CDS       T00277                                 

Definition
(GenBank) Glycoside hydrolase, family 10
  KO
K01181  endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
ava  Trichormus variabilis
Brite
Enzymes [BR:ava01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.8  endo-1,4-beta-xylanase
     Ava_1373
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_10 Glyco_hydro_42
Motif
Other DBs
NCBI-ProteinID: ABA20997
JGI: Ava1373
CyanoBase: Ava_1373
CYORF: Ava_1373
UniProt: Q3MDD9
Position
1693076..1694224
Genome map
AA seq 382 aa AA seqDB search
MFHRRKFLKRAGYTTLSAFLTMGFLQRDKQRDIRSTDIAAINTNFPLQQLAAAKGKRYGA
AVDSETLKKYPDYAKLIARECSIVTPNGELKWNATEPQPGYFTFAAADAIANFCQKNNLK
MHGHTLFWNMAKPDWLPYPPTLPMIERHFNGVMGHYRHSQVLTSWDIANEIIAYSEDEAK
ASTYGLHKGVKPELIRDVFLIAASIDSSKKFYLNDFSIEGDTWKSRYFLKMIEYLKNNGA
KIDGAGIQSHLWFSTNYPFDEKGFVGVLKRLKELEVKPVITELDIIIDTPLPDTIEKLDQ
MVADSYKRYLDLCFANGVDTIITWGITDRHSWIRHPDWMPQKFKGNPSYHKFLRPLPYDE
NLKPKLARKAIAQSFIKAAASI
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgttccatcggagaaaatttctaaagagagcaggatacacaactctatctgctttcttg
acgatggggtttttacaaagggataaacagagggatattcgtagtacggatattgcggca
ataaatacgaattttccgttgcagcaattagctgctgccaaaggaaaacgctatggtgca
gcagttgacagtgaaactttaaaaaaatatcccgactacgcaaaattaattgcccgtgaa
tgttcaattgtgacacccaatggcgaattaaagtggaatgccactgaaccgcagccagga
tattttacttttgcagcagctgatgcgatcgccaacttctgccaaaagaataacttgaaa
atgcacggacataccctgttctggaacatggcaaaaccagactggcttccttaccccccc
actctacccatgatcgaacggcactttaacggcgtgatggggcattatcgccatagtcag
gttttaacatcttgggatatcgctaatgaaattattgcctacagtgaagacgaagctaag
gcctctacctatggcttacataaaggcgtaaaaccagaattaattcgagatgtgttttta
atcgccgcttcgattgatagcagcaagaaattttacctcaatgatttctccattgaaggt
gatacctggaaatccaggtatttcttaaaaatgattgagtatctcaagaataatggcgcg
aagatagatggagcaggtatccagtcccatctgtggttttctaccaattatccttttgat
gaaaaaggatttgttggtgttttaaaaaggctcaaagaactggaagttaaaccagtaatt
accgaactagatattattattgatacccctctaccagacactatcgaaaagctcgatcaa
atggtggcagactcttataagcgatatcttgacttatgctttgccaatggagtcgatacc
atcattacctggggtattactgatcgccatagctggatacgtcaccctgattggatgccg
caaaaatttaagggaaatcccagctaccataagtttttgcgtccacttccctacgacgag
aatctgaaacctaaacttgctcgtaaagcgatcgcccaatcttttatcaaggctgctgct
tcaatatga

DBGET integrated database retrieval system