KEGG   Anabaena variabilis: Ava_1429Help
Entry
Ava_1429          CDS       T00277                                 

Definition
glycoside hydrolase (EC:2.4.1.19)
Orthology
K00701  
cyclomaltodextrin glucanotransferase [EC:2.4.1.19]
Organism
ava  Anabaena variabilis
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
1766415..1768343
Genome map
AA seq 642 aa AA seqDB search
MVQTPPSQFSEEQYKVENANAEVQALIESPTPDTEIDLEFLYTRDIEFRQETIYFLVVDR
FYDGDAENSEGYNPELYDPNGKDWGKYWGGDLQGVIDKLDYLKDMGVTALWLTPLFEQVE
ELFVGNAAMHGYWTKDFKRLNPRYIGNGEDPSLNNTQETRNTTFDRLIAELHKRKMKLIL
DIVCNHSSPDTSGSKGELYDDGVKIADFNDDVNHWYHHYGEVQNWEDDWQVQNCELAGLA
TFNENNTEYRNYIKSAIKQWLDRGVDALRVDTVKHMPIWFWQEFTGDMYNHKPDVFIFGE
WIYNYPSDDRSVEFANNSGMTLLDFGLCVAIRGALAQGAEGGFHLIQEIFDQDDRYNGAT
ELITFVDNHDMPRFQSLNPDPAMLKVAIALIMTSRGIPCIYYGTEQYLHDDTNGGNDPYN
RPMMENWDTDTEVYRYLRLLSGIRRLNPAVSMGSQWQKYLTPDVYCYVRRYRSSVCFVAL
NRGGEVTLPEVQTDLPDGEHTCAVTRNKFEVKDGKIYNLQLEERGVIVLSHVGERVKAQT
IIRVQLNGVHTQPGETIVVVGDCPELGNWDISKAYPLEYINSNTWFAEIPFDESAGKLIS
YKYAMWREGRSPLRENTLNRRWVVAKEGTVKWRDTWASGRES
NT seq 1929 nt NT seq  +upstreamnt  +downstreamnt
atggtacaaacaccaccatcacaattttccgaagagcaatacaaagtcgaaaatgctaat
gcagaggtacaagcattaatcgaatcgcctacgccagatacagaaatagatttagaattt
ctctacactagagatattgaatttcgccaagaaactatttacttcctcgttgtagatcgc
ttttatgatggcgatgctgaaaatagcgaaggttataatccagaactttatgaccccaat
gggaaagattggggcaagtattgggggggtgacttacaaggagtaatcgacaaattagac
tacttgaaagatatgggagtaaccgcactttggctaactcctttatttgaacaagtcgag
gaattatttgttggtaacgcagccatgcacggctattggacaaaagattttaaacggcta
aatcctcgctacattggtaatggagaagatccttccttaaacaatactcaagaaaccaga
aatacgacttttgaccgcttaattgcagaattacacaagcggaaaatgaagctgatacta
gatattgtctgtaaccatagcagtcctgatactagtggtagcaaaggtgagttatatgat
gacggcgtaaaaattgccgactttaatgatgatgtgaatcactggtatcaccactatggt
gaagtgcagaactgggaagatgattggcaagtccaaaactgtgaactggctggtttagct
acttttaatgaaaataatactgagtatcgtaactatatcaagtctgcaattaagcaatgg
ctagaccggggtgtggatgcgctgcgggtagatacagtcaaacatatgccaatttggttt
tggcaagaatttactggtgatatgtataatcacaaaccagatgtatttatttttggtgag
tggatttacaattatcccagtgacgatcgctcggtggaatttgccaataattccggtatg
actttacttgattttggtctgtgcgtagcaattcgcggcgcattagcccaaggtgcggaa
gggggattccatctcatccaagaaatattcgaccaagatgatcgctacaacggggctacg
gagttaatcacctttgttgataaccatgatatgccccgctttcaatccctcaaccccgat
ccagcgatgttgaaagtagcgatcgctctcattatgacatcacggggtattccatgtatc
tattacggtacagaacaatatctgcacgatgataccaacggcggtaatgacccctataac
cgccccatgatggaaaattgggatactgatactgaggtttatagatacctccgattgttg
tctggtatccgacggttaaatccagccgtctctatgggtagccagtggcaaaaatacctc
acacccgatgtttattgttatgtccgccgttatcgttcttctgtttgcttcgtcgccctt
aatcgtggtggagaggtgactttaccagaagtccaaacagacttaccagatggtgaacat
acttgtgcggtgactcggaataaatttgaggtaaaagacggtaaaatttacaatctacaa
ctggaagaacggggagtcatcgttttaagtcatgtaggcgaacgagtaaaagcgcaaacc
attatccgcgttcaacttaatggtgtacatactcaaccaggggaaactatcgtagttgtc
ggcgactgtccagaattgggtaactgggatattagtaaagcctatcccctggaatatatc
aactctaatacttggtttgccgaaattccctttgatgaaagtgcaggcaaactcattagt
tacaaatatgccatgtggcgtgaagggcgatcgcctctgcgagaaaataccttaaatcgt
cgctgggtagtggcgaaggaaggcactgttaaatggcgtgatacttgggcttctgggaga
gagtcttaa

DBGET integrated database retrieval system