KEGG   Trichormus variabilis: Ava_1435Help
Entry
Ava_1435          CDS       T00277                                 

Definition
(GenBank) UDP-N-acetylglucosamine 1-carboxyvinyltransferase
  KO
K00790  UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
ava  Trichormus variabilis
Pathway
ava00520  Amino sugar and nucleotide sugar metabolism
ava00550  Peptidoglycan biosynthesis
ava01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ava00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Ava_1435
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Ava_1435
Enzymes [BR:ava01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     Ava_1435
Peptidoglycan biosynthesis and degradation proteins [BR:ava01011]
 Precursor biosynthesis
  Transferase/Dehydrogenase
   Ava_1435
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: EPSP_synthase
Motif
Other DBs
NCBI-ProteinID: ABA21058
JGI: Ava1435
CyanoBase: Ava_1435
CYORF: Ava_1435
UniProt: Q3MD78
Position
complement(1775239..1776582)
Genome map
AA seq 447 aa AA seqDB search
MPEADSSVLQIWGGHPLRGHVKISGAKNSALVIMAGALLCSGDCRIRNVPLLADVERMGE
VISALGVRLTRQADIIDINASEIKTSKAPYELVTQLRASFFAIGAILARLGVAQMPLPGG
CAIGARPVDLHVRGLQAMGAEVQIEHGICNAYVPGSGGRLKGAKIYLDTPSVGATETLMM
AATLADGETILENAAREPEVVDLANFCKAMGANIQGAGTSTITIVGVPKLHSVDYSIIPD
RIEAGTFLVAGAITRSEITLSSVVPDHLIPLIAKLRDIGVTIIEESPDCLRILPAEILKA
TDIDTLPHPGFPTDMQAPFMALLTLAEGDSIINESVFENRLRHASELNRLGADIRVKGNT
AFVRGVPILSGAPVIGTDLRASAALVIAGLAAEGKTTIQGLHHLDRGYDQIDVKLQQLGA
KILRVREEPANAEVAANNNASPAPIST
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
gtgccagaagcagactcctcagtcttgcaaatttggggtgggcatcccttacggggtcat
gtcaaaattagcggggcaaaaaattcagcattggtaatcatggctggagccttgctttgt
tcaggagattgccggattcgtaacgttcctttattggcggacgtagaacgaatgggtgaa
gtaatatcggcgttaggtgtacgcttgacacgacaagcagacatcatagacatcaatgcc
agcgaaattaagacatcaaaagctccctacgagctagttacccagttacgagcgagtttc
tttgccataggagccattttggcaaggttaggcgttgcacagatgccattacctggcggt
tgtgccataggagccagacccgttgatctgcacgtccgaggactgcaagcaatgggcgca
gaggtgcaaattgaacatggcatttgtaacgcctatgttcctggtagtggtggtaggttg
aaaggagccaaaatttacctagatactcccagtgtgggagcgacagaaaccttgatgatg
gcagccaccctcgccgatggcgaaaccatcttggaaaacgctgcacgggagccagaagta
gtcgatttggctaatttctgcaaggcaatgggagctaatattcagggcgctggcactagt
acaattactattgttggtgttcctaaattacactctgttgactacagtattattcccgat
cgcattgaggctggaactttcctcgttgccggagctatcacccgttccgaaattactctt
tcctcagtagtaccagatcatttaatcccgttaattgccaagttgcgggatattggcgta
accatcattgaggaaagtccagattgcttacgcattcttcctgccgaaattctcaaggct
acggatattgataccttgccccatcctgggttccccacggatatgcaggcaccatttatg
gccttgttaactttggcagaaggcgacagcattattaacgaatcagtatttgaaaatcgc
ttgcgccatgcctcagagttaaatcgcttaggggcagatattcgggtgaaaggcaatact
gcttttgtgcgcggagtgccaattttatcaggtgcgccagtcatcggcacagacttacga
gcatcagccgcgttagtcatagccggattagccgccgaaggtaaaactaccattcagggc
ttacatcatcttgatcggggctacgatcaaattgatgtaaagttgcaacaattgggagct
aaaatccttcgagtacgcgaggagccagcaaatgctgaagtagccgctaataacaatgcg
tcgccagcgccgatttctacttag

DBGET integrated database retrieval system