KEGG   Trichormus variabilis: Ava_1475Help
Entry
Ava_1475          CDS       T00277                                 

Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
ava  Trichormus variabilis
Pathway
ava00230  Purine metabolism
ava01100  Metabolic pathways
Module
ava_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:ava00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Ava_1475
Enzymes [BR:ava01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     Ava_1475
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_16 AAA_33 AAA_22 AAA_18 RsgA_GTPase MMR_HSR1 AAA_28 ABC_tran AAA_30 AAA_29 ATPase_2 AAA_14 cobW TsaE NTPase_1 AAA_17 AAA Cytidylate_kin NACHT RNA_helicase NB-ARC
Motif
Other DBs
NCBI-ProteinID: ABA21098
JGI: Ava1475
CyanoBase: Ava_1475
CYORF: Ava_1475
UniProt: Q3MD38
Position
1821603..1822202
Genome map
AA seq 199 aa AA seqDB search
MMQVLSIQNCATTKENPSSGKLIVLTGPSGVGKGTLMRSLLQRHPELYYSVSATTRAPRP
GEVNGESYYFISRNKFEELLAQGEFLESAEFAGNYYGTPREAVLNQIQSGKLVVLEIELA
GARQIRASFPEALSIFILPPSFEELEKRIRGRGQDSEEAIARRLQRATEEIQAADEFDIQ
IVNDDFEAALQAIEVALFG
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgatgcaagttttatccatccagaattgtgctactaccaaagaaaatccatcgtcaggc
aagctgattgttttaaccgggcctagtggggtcggtaaaggtactttaatgcgatcgctc
cttcagcgtcatccggaactttattactctgtatctgcaacaactcgcgctccccgtcct
ggggaagtaaatggcgaaagctattacttcattagccgcaacaaatttgaagaattgctt
gctcaaggcgaatttctcgaatcggcagaatttgcgggtaattattatggcactcctcgt
gaagctgtactgaaccaaattcaatctggtaagttagttgtgctggaaattgaactagcc
ggggcaagacaaattcgtgcttctttccctgaagcgttgagtatttttattctgccgcct
tcctttgaagagttggagaaacggattcggggacgtggacaggactcagaggaagcgatc
gcccgtcgcttacaacgtgccacagaagagattcaagctgcggatgaatttgatattcaa
attgtgaatgacgattttgaagctgcactccaggcgatcgaagtagctttatttggataa

DBGET integrated database retrieval system