KEGG   Anabaena variabilis: Ava_1495Help
Entry
Ava_1495          CDS       T00277                                 

Definition
sulfate transport system permease 1 (EC:3.6.3.25)
Orthology
K02045  
sulfate transport system ATP-binding protein [EC:3.6.3.25]
Organism
ava  Anabaena variabilis
Pathway
Sulfur metabolism
ABC transporters
Module
Sulfate transport system
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:ava00920]
Environmental Information Processing; Membrane transport; ABC transporters [PATH:ava02010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(1841754..1842770)
Genome map
AA seq 338 aa AA seqDB search
MGIVVENVSKQFGSFRAVDQVNLEIQSGKLVALLGPSGSGKSTLLRLIAGLEKPDDGRII
LTGKDATNQSVQERNIGFVFQHYALFKHLTVRQNIAFGLEIRKAPANKVKGRVEQLLELV
QLSGLGDRYPSQLSGGQRQRVALARALAVEPSVLLLDEPFGALDAKVRKDLRAWLRRLHD
EVHVTTVFVTHDQEEAMEVSDEVVVMNQGRVEQVGTPAEIYDNPATSFVMSFIGPVNVLP
SSSRIFQSSQLEIEHPNVFLRPQDVVIEKSANGTTAPATVTRLIHLGWEIKVELTLDDGQ
VVNAHLTRDRYDELQLEPKQKVYVKPKDAKSFPLYYSI
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
gtgggcatagtagttgaaaacgtatccaaacaattcggtagtttccgagcggttgatcag
gtaaacttagaaatccaaagcgggaaactggtagccctgttagggccatcgggatctggt
aagtctacgttgctccgcttaattgctggtctcgaaaagccagacgatggcagaattatt
ctgacgggaaaagacgctacaaaccaaagtgtacaagaacgtaacattgggtttgtattt
caacactatgctttatttaagcatctgacagtccggcaaaacatcgcttttgggttagaa
attcgcaaagcaccagcgaataaagtcaaagggcgggtagaacagttattagaactagtg
cagttgagtgggctaggcgatcgctatccttctcagctttccggtggtcaaagacaaagg
gtagccttagctagagccttagcagtagaacctagtgtattacttttagatgaacccttt
ggcgcacttgatgccaaagtccgtaaagacttacgcgcatggttacgccgtctccatgat
gaagttcacgttaccacagtttttgtcacccacgaccaagaagaagcaatggaagtttct
gatgaggtcgtagtcatgaatcaagggcgtgtagaacaggtaggaacacccgcagaaatt
tacgacaatccagctacgtcctttgtgatgagtttcattgggccagtaaatgtcttgcca
agtagctccagaattttccaaagtagccagttagagatagaacatccaaacgtattttta
cgcccacaagatgtagtgatcgagaaatctgctaacggcacaaccgcacctgctacagtc
actcgattgatccacttgggctgggaaatcaaagttgaattaaccttagacgatggacaa
gttgtcaacgctcatttaacacgcgatcgctacgatgagctacagttggaaccaaagcaa
aaggtatatgtaaaacctaaggatgcgaaatcttttcctttgtattactcgatttaa

DBGET integrated database retrieval system