KEGG   Trichormus variabilis: Ava_1519Help
Entry
Ava_1519          CDS       T00277                                 

Definition
(GenBank) protoporphyrin IX magnesium-chelatase
  KO
K03405  magnesium chelatase subunit I [EC:6.6.1.1]
Organism
ava  Trichormus variabilis
Pathway
ava00860  Porphyrin and chlorophyll metabolism
ava01100  Metabolic pathways
ava01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ava00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Ava_1519
Enzymes [BR:ava01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     Ava_1519
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mg_chelatase AAA_5 MCM AAA_22 AAA_16 Sigma54_activat AAA_29 AAA DUF815 ABC_tran AAA_28 AAA_18 RNA_helicase AAA_27 AAA_30 AAA_7
Motif
Other DBs
NCBI-ProteinID: ABA21142
JGI: Ava1519
CyanoBase: Ava_1519
CYORF: Ava_1519
UniProt: Q3MCZ4
Position
complement(1867130..1868254)
Genome map
AA seq 374 aa AA seqDB search
MTPTAQTTASARRVVFPFTAIVGQEEMKLALLLNVIDPKIGGVMIMGDRGTGKSTTIRAL
ADLLPEIPVVANDPFNSDPSDPDLMSDEVRQKSGAGAEIPIEFKKVQMVDLPLGATEDRV
CGTIDIEKALSEGVKAFEPGLLAKANRGILYVDEVNLLDDHLVDVLLDSAASGWNTVERE
GISIRHPARFVLVGSGNPEEGELRPQLLDRFGMHAEIHTVKEPALRVQIVEQRSEFDQNP
PTFLEKYNSEQTALQEKIVNAQKLLPEVKLDYDLRVKISEVCSELDVDGLRGDIVTNRAA
KALTAYEGRTEVTVDDIRRVITLCLRHRLRKDPLESIDSGYKVEKVFARIFGVEILEEES
SQKNGTGQIKTGVR
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
gtgactccaactgctcaaaccacggcaagcgcgcgtcgcgtggtattcccatttacggca
attgtgggccaggaagagatgaaactggcgctgctgttgaacgtgattgatcccaaaatc
ggtggtgtaatgattatgggcgatcgcggcacaggtaaatccacaactatccgggccctg
gccgacctattgccagaaatccctgtagttgccaatgaccccttcaacagtgaccccagc
gaccccgacttgatgagcgatgaagtccggcaaaaatcaggcgcaggggcagaaattccc
atagaatttaagaaagtccaaatggtagacctgcccttaggcgctacagaagaccgagtg
tgcggtactatcgacatcgaaaaagctttatctgaaggtgtcaaagcttttgaaccagga
ctcctcgctaaagcaaacagaggtattctctacgtcgatgaagtcaacctcctagatgac
cacctagtagacgtacttctcgactcagccgcaagtggctggaacaccgtagaacgtgaa
ggtatttccatccgccacccagcccgttttgtactcgtcggttcaggaaacccagaagaa
ggcgaactccgaccccaattgcttgaccgcttcggaatgcacgccgaaatccacaccgtt
aaagaaccggctttacgtgtgcaaatcgtggaacaaaggtcagaatttgaccaaaatccc
ccaacattcctagaaaagtacaactctgagcaaacagcactacaagagaaaattgtcaat
gcccaaaagcttttgccagaagtaaaactagattatgacctgcgggtaaaaatttcggaa
gtttgttcagaactagatgtagacggtttacgcggtgacatcgtgaccaaccgcgccgcc
aaagccctcacagcttatgagggacgcacagaagttacagttgacgacatccgtcgtgta
attacattatgtttgcgtcaccgcttgcggaaagaccccctagaatcaattgattctggc
tacaaagtagagaaagtgtttgcccgcatctttggggtagaaatactagaagaagaatct
tcacaaaaaaacggtacaggtcaaattaagacaggtgtccggtaa

DBGET integrated database retrieval system