KEGG   Anabaena variabilis: Ava_1519Help
Entry
Ava_1519          CDS       T00277                                 

Definition
protoporphyrin IX magnesium-chelatase (EC:6.6.1.1)
Orthology
K03405  
magnesium chelatase subunit I [EC:6.6.1.1]
Organism
ava  Anabaena variabilis
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ava00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Ava_1519
Enzymes [BR:ava01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     Ava_1519
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(1867130..1868254)
Genome map
AA seq 374 aa AA seqDB search
MTPTAQTTASARRVVFPFTAIVGQEEMKLALLLNVIDPKIGGVMIMGDRGTGKSTTIRAL
ADLLPEIPVVANDPFNSDPSDPDLMSDEVRQKSGAGAEIPIEFKKVQMVDLPLGATEDRV
CGTIDIEKALSEGVKAFEPGLLAKANRGILYVDEVNLLDDHLVDVLLDSAASGWNTVERE
GISIRHPARFVLVGSGNPEEGELRPQLLDRFGMHAEIHTVKEPALRVQIVEQRSEFDQNP
PTFLEKYNSEQTALQEKIVNAQKLLPEVKLDYDLRVKISEVCSELDVDGLRGDIVTNRAA
KALTAYEGRTEVTVDDIRRVITLCLRHRLRKDPLESIDSGYKVEKVFARIFGVEILEEES
SQKNGTGQIKTGVR
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
gtgactccaactgctcaaaccacggcaagcgcgcgtcgcgtggtattcccatttacggca
attgtgggccaggaagagatgaaactggcgctgctgttgaacgtgattgatcccaaaatc
ggtggtgtaatgattatgggcgatcgcggcacaggtaaatccacaactatccgggccctg
gccgacctattgccagaaatccctgtagttgccaatgaccccttcaacagtgaccccagc
gaccccgacttgatgagcgatgaagtccggcaaaaatcaggcgcaggggcagaaattccc
atagaatttaagaaagtccaaatggtagacctgcccttaggcgctacagaagaccgagtg
tgcggtactatcgacatcgaaaaagctttatctgaaggtgtcaaagcttttgaaccagga
ctcctcgctaaagcaaacagaggtattctctacgtcgatgaagtcaacctcctagatgac
cacctagtagacgtacttctcgactcagccgcaagtggctggaacaccgtagaacgtgaa
ggtatttccatccgccacccagcccgttttgtactcgtcggttcaggaaacccagaagaa
ggcgaactccgaccccaattgcttgaccgcttcggaatgcacgccgaaatccacaccgtt
aaagaaccggctttacgtgtgcaaatcgtggaacaaaggtcagaatttgaccaaaatccc
ccaacattcctagaaaagtacaactctgagcaaacagcactacaagagaaaattgtcaat
gcccaaaagcttttgccagaagtaaaactagattatgacctgcgggtaaaaatttcggaa
gtttgttcagaactagatgtagacggtttacgcggtgacatcgtgaccaaccgcgccgcc
aaagccctcacagcttatgagggacgcacagaagttacagttgacgacatccgtcgtgta
attacattatgtttgcgtcaccgcttgcggaaagaccccctagaatcaattgattctggc
tacaaagtagagaaagtgtttgcccgcatctttggggtagaaatactagaagaagaatct
tcacaaaaaaacggtacaggtcaaattaagacaggtgtccggtaa

DBGET integrated database retrieval system