KEGG   Anabaena variabilis: Ava_1747Help
Entry
Ava_1747          CDS       T00277                                 

Definition
thioredoxin-like protein (EC:5.3.4.1)
Orthology
K01829  
protein disulfide-isomerase [EC:5.3.4.1]
K03671  
thioredoxin 1
Organism
ava  Anabaena variabilis
Brite
Enzymes [BR:ava01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     Ava_1747
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(2180756..2181142)
Genome map
AA seq 128 aa AA seqDB search
MVLSVSERTFTQEVLESPVPVLVNFEAPWCGLCRIIHPLLLQFQSQCGEQIKLVGVNADE
NFKLSNTYRLKSLPTLLLIENGIIRHRLEGFRGRDDLRLALEEIRLSYTNRPKAYSSSKT
ADLECRTA
NT seq 387 nt NT seq  +upstreamnt  +downstreamnt
atggtgttgtcggttagtgagcggacatttactcaagaagttttagaatctccggttccg
gttttagtaaattttgaagcaccctggtgtgggttgtgtcgcattatccaccctttgtta
ttacaatttcaatctcaatgcggcgaacaaattaaactagttggggtgaacgctgacgag
aatttcaaactttctaacacttatcgtttaaagtctttgcccacgttacttttgattgaa
aatgggatcattcgccatcgtctagaagggtttcgcggcagagatgacttacgattggcg
ttggaagaaatcagactcagttataccaaccgccctaaagcctacagtagctctaaaacg
gcagacttagaatgtcggacagcgtga

DBGET integrated database retrieval system