KEGG   Anabaena variabilis: Ava_1781Help
Entry
Ava_1781          CDS       T00277                                 

Definition
hypothetical protein
Orthology
K01317  
acrosin [EC:3.4.21.10]
Organism
ava  Anabaena variabilis
Brite
Enzymes [BR:ava01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.10  acrosin
     Ava_1781
Peptidases [BR:ava01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   Ava_1781
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
2221328..2222491
Genome map
AA seq 387 aa AA seqDB search
MRLNLIPLFSLGLCGVMVLISPPQVNANTPLNRAEVQSIRNFVQLIQRASRNKRPAQKLD
AIIPGDGLSTGRASLADLRFNDGSLARVGEQAVFQFMPRTRNFRLSNGTVLLLIPPGRGQ
TRIQTPSATAAIRGSALFIRYDQKTDTTIIGALTNSGIAVSNKDASQTQPLKAGQLLVLV
KGEIQSLYDFDLQNFYETSDLAEGLDLTGKNSSATPDPAIAGVRAEIMAALATQSPLVGK
GVMENPAFLELSTTSSEVIDEDTDEDDFITDNFLVDSLVETGEILFQNAQQLGDNADGNL
NNINNIQPDPPLPDNPDPPPPPPDPPPPPPPDPPPPPPPDPPPPPPPDPPPPPPPDPPPP
PPPDPPPPPPPDPPPPPPPDPPPPPPP
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atgcgcttgaaccttatcccattattttcccttggattatgcggggtgatggtattgatt
tcgccacctcaggtgaatgccaatactcccttaaatcgtgctgaggttcagagcattcgt
aactttgtgcaattaattcaaagagcatctagaaataaacgtccagcacagaaattggat
gcaattattccaggggatggactatcaactggtcgagcttctttagcagacttgcgtttc
aacgacggttctctggcaagggttggagaacaagcagtatttcaatttatgcccaggacg
cggaattttcgattgtctaatgggacagtattactactaattccaccaggaagaggacaa
acacgtattcaaacaccaagcgcaacagccgccattcgtggttcggcgctattcattcgt
tatgaccaaaaaacggatacgacgattattggtgcgctgacaaatagtgggatagcagtg
tctaacaaggacgcatctcaaactcaaccgctaaaagcaggacaacttttagttcttgtc
aaaggtgaaattcagagtttatatgattttgatctacaaaatttttatgaaacaagtgat
ttggctgagggtttagatttaactggcaaaaactcttcagcaacaccagacccagctatt
gcgggtgtcagagcagaaattatggccgcgttggcaacacagtcacctctcgttggtaaa
ggggtgatggaaaacccagcttttttagaactaagtactacttcctctgaggtaatagat
gaagatactgacgaagatgatttcataaccgataattttctggttgattcattagtagaa
acaggagaaattttgttccaaaatgctcaacaacttggggataatgctgatggcaatcta
aataatatcaataatatacaaccagacccgcctctacccgacaacccagacccaccgcca
ccaccaccagacccaccgccaccaccaccaccagacccaccaccgccaccaccaccagac
ccaccaccgccaccaccaccagacccaccaccaccaccaccaccagacccaccaccacca
ccaccaccagacccaccaccgccaccaccaccagacccaccaccgccaccaccaccagac
ccaccaccaccaccaccgccctaa

DBGET integrated database retrieval system